From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005998000
  • symbol?: opuCC
  • description?: glycine betaine/carnitine/choline ABC transporter

      descriptions from strain specific annotations:

    • glycine betaine/carnitine/choline ABC transporter
    • substrate-binding region of ABC-type glycine betaine transport system
    • amino acid ABC transporter substrate-binding protein
    • glycine betaine/carnitine/choline-binding (Osmoprotectant-binding protein)
    • glycine betaine/carnitine/choline ABC transporter opuCC
    • OsmotiCALL import_20_25_26_pangenomey activated L-carnitine/choline ABC transporter, substrate-binding protein OpuCC
    • glycine betaine/carnitine/choline-binding lipoprotein precursor
    • glycine betaine/carnitine/choline ABC transporter opuCC (osmoprotec)
    • putative glycinebetaine/carnitine/choline-binding lipoprotein precursor
    • amino acid ABC transporter amino acid-binding protein
    • amino acid transporter
    • glycine betaine/L-proline ABC transporter binding protein
    • glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, binding protein
    • betaine-carnitine-choline ABC transporter
    • glycine betaine/carnitine/choline-binding protein (Osmoprotectant-binding protein)
  • strand?: -
  • coordinates?: 6059967..6060908
  • synteny block?: BlockID0047420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2235 (opuCC)
    NCTC8325:
    Newman:
    NWMN_2345 (opuCC)
    USA300_FPR3757:
    SAUSA300_2391 (opuCc)
    04-02981:
    SA2981_2383 (opuCC)
    08BA02176:
    C248_2496 (opuCC)
    11819-97:
    MS7_2460 (opuCC)
    71193:
    ST398NM01_2498
    ECT-R 2:
    ECTR2_2304
    ED133:
    SAOV_2496c
    ED98:
    SAAV_2512
    HO 5096 0412:
    SAEMRSA15_23460 (opuCC)
    JH1:
    SaurJH1_2521
    JH9:
    SaurJH9_2473
    JKD6008:
    SAA6008_02488 (opuCC)
    JKD6159:
    SAA6159_02344 (opuCC)
    LGA251:
    SARLGA251_22270 (opuCC)
    M013:
    M013TW_2409
    MRSA252:
    SAR2536 (opuCC)
    MSHR1132:
    SAMSHR1132_22740
    MSSA476:
    SAS2338
    Mu3:
    SAHV_2430 (opuCC)
    Mu50:
    SAV2446 (opuCC)
    MW2:
    MW2370 (opuCC)
    RF122:
    SAB2328c (opuCC)
    ST398:
    SAPIG2498
    T0131:
    SAT0131_02645 (ftsY)
    TCH60:
    HMPREF0772_10742 (opuCC)
    TW20:
    SATW20_25750 (opuCC)
    USA300_TCH1516:
    USA300HOU_2435 (opuBC)
    VC40:
    SAVC_11105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIKYILVVFVLSLTVLSGCSLPGLGSKSTKNDVKITALSTSESQIISHMLRLLIEHDT
    N315            MKKIKYILVVFVLSLTVLSGCSLPGLGSKSTKNDVKITALSTSESQIISHMLRLLIEHDT
    NCTC8325        MKKIKYILVVFVLSLTVLSGCSLPGLGSKSTKNDVKITALSTSESQIISHMLRLLIEHDT
    Newman          MKKIKYILVVFVLSLTVLSGCSLPGLGSKSTKNDVKITALSTSESQIISHMLRLLIEHDT
    USA300_FPR3757  MKKIKYILVVFVLSLTVLSGCSLPGLGSKSTKNDVKITALSTSESQIISHMLRLLIEHDT
                    ************************************************************

    COL             HGKIKPTLVNNLGSSTIQHNALINGDANISGVRYNGTDLTGALKEAPIKNPKKAMIATQQ
    N315            HGKIKPTLVNNLGSSTIQHNALINGDANISGVRYNGTDLTGALKEAPIKDPKKAMIATQQ
    NCTC8325        HGKIKPTLVNNLGSSTIQHNALINGDANISGVRYNGTDLTGALKEAPIKNPKKAMIATQQ
    Newman          HGKIKPTLVNNLGSSTIQHNALINGDANISGVRYNGTDLTGALKEAPIKNPKKAMIATQQ
    USA300_FPR3757  HGKIKPTLVNNLGSSTIQHNALINGDANISGVRYNGTDLTGALKEAPIKNPKKAMIATQQ
                    *************************************************:**********

    COL             GFKKKFDQTFFDSYGFANTYAFMVTKETAKKYHLETVSDLAKHSKDLRLGMDSSWMNRKG
    N315            GFKKKFDQTFFDSYGFANTYAFMVTKETAKKYHLETVSDLAKHSKDLRLGMDSSWMNRKG
    NCTC8325        GFKKKFDQTFFDSYGFANTYAFMVTKETAKKYHLETVSDLAKHSKDLRLGMDSSWMNRKG
    Newman          GFKKKFDQTFFDSYGFANTYAFMVTKETAKKYHLETVSDLAKHSKDLRLGMDSSWMNRKG
    USA300_FPR3757  GFKKKFDQTFFDSYGFANTYAFMVTKETAKKYHLETVSDLAKHSKDLRLGMDSSWMNRKG
                    ************************************************************

    COL             DGYEGFKKEYGFDFGTVRPMQIGLVYDALNSEKLDVALGYSTDGRIAAYDLKVLKDDKQF
    N315            DGYEGFKKEYGFDFGTVRPMQIGLVYDALNTEKLDVALGYSTDGRIAAYDLKVLKDDKQF
    NCTC8325        DGYEGFKKEYGFDFGTVRPMQIGLVYDALNSEKLDVALGYSTDGRIAAYDLKVLKDDKQF
    Newman          DGYEGFKKEYGFDFGTVRPMQIGLVYDALNSEKLDVALGYSTDGRIAAYDLKVLKDDKQF
    USA300_FPR3757  DGYEGFKKEYGFDFGTVRPMQIGLVYDALNSEKLDVALGYSTDGRIAAYDLKVLKDDKQF
                    ******************************:*****************************

    COL             FPPYAASAVATNELLRQHPELKTTINKLTGKISTSEMQRLNYEADGKGKEPAVVAEEFLK
    N315            FPPYAASAVATNELLRQHPELKTTINKLTGKISTSEMQRLNYEADGKGKEPAVVAEEFLK
    NCTC8325        FPPYAASAVATNELLRQHPELKTTINKLTGKISTSEMQRLNYEADGKGKEPAVVAEEFLK
    Newman          FPPYAASAVATNELLRQHPELKTTINKLTGKISTSEMQRLNYEADGKGKEPAVVAEEFLK
    USA300_FPR3757  FPPYAASAVATNELLRQHPELKTTINKLTGKISTSEMQRLNYEADGKGKEPAVVAEEFLK
                    ************************************************************

    COL             KHHYFDKQKGGHK
    N315            KHHYFDKQKGGHK
    NCTC8325        KHHYFDKQKGGHK
    Newman          KHHYFDKQKGGHK
    USA300_FPR3757  KHHYFDKQKGGHK
                    *************