From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006097000
  • symbol?: fnbB
  • description?: Fibronectin binding protein FnbB

      descriptions from strain specific annotations:

    • Fibronectin binding protein FnbB
    • fibronectin binding protein B
    • fibronectin-binding protein
    • cell wall anchor domain-containing protein
    • fibronectin-binding protein A
    • fibronectin binding protein B precursor
    • fibronectin-binding protein precursor
  • strand?: -
  • coordinates?: 6148339..6177780
  • synteny block?: BlockID0048340
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2509 (fnbB)
    N315:
    SA2290 (fnbB)
    NCTC8325:
    Newman:
    NWMN_2397 (fnbB)
    USA300_FPR3757:
    04-02981:
    SA2981_2438 (fnbB)
    08BA02176:
    11819-97:
    MS7_2504
    71193:
    ECT-R 2:
    ECTR2_2354
    ED133:
    SAOV_2544c
    ED98:
    SAAV_2566 (fnbB)
    HO 5096 0412:
    JH1:
    SaurJH1_2577
    JH9:
    SaurJH9_2525
    JKD6008:
    SAA6008_02536
    JKD6159:
    LGA251:
    SARLGA251_22760 (fnbB)
    M013:
    M013TW_2467
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2387 (fnbB)
    Mu3:
    SAHV_2486 (fnbB)
    Mu50:
    SAV2502 (fnbB)
    MW2:
    MW2420 (fnbB)
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10696 (fnbB)
    TW20:
    SATW20_26210 (fnbB)
    USA300_TCH1516:
    USA300HOU_2490 (fnbB)
    VC40:
    SAVC_11375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSNLRYGIRKHKLGAASVFLGTMIVVGMGQEKEAAASEQNNTTVEESGSSATESKASET
    N315            MKSNLRYGIRKHKLGAASVFLGTMIVVGMGQEKEAAASEQNNTTVEESGSSATESKASET
    NCTC8325        -----------------------MIVVGMGQEKEAAASEQNNTTVEESGSSATESKASET
    Newman          MKSNLRYGIRKHKLGAASVFLGTMIVVGMGQEKEAAASEQNNTTVEESGSSATESKASET
    USA300_FPR3757  MKSNLRYGIRKHKLGAASVFLGTMIVVGMGQEKEAAASEQNNTTVEESGSSATESKASET
                                           *************************************

    COL             QTTTNNVNTIDETQSYSATSTEQPSQSTQVTTEEAPKTVQAPKVET---SRVDLPSEKVA
    N315            QTTTNNVNTIDETQSYSATSTEQPSKSTQVTTEEAPTTVQAPKVETEMKSQEDLPSEKVA
    NCTC8325        QTTTNNVNTIDETQSYSATSTEQPSQSTQVTTEEAPKTVQAPKVET---SRVDLPSEKVA
    Newman          QTTTNNVNTIDETQSYSATSTEQPSQSTQVTTEEAPKTVQAPKVET---SRVDLPSEKVA
    USA300_FPR3757  QTTTNNVNTIDETQSYSATSTEQPSQSTQVTTEEAPKTVQAPKVET---SRVDLPSEKVA
                    *************************:**********.*********   *: ********

    COL             DKETTGTQVDIAQPSNVSEIKPRMKRSTDVTAVAEKEVVEETKATGTDVTNKVEVEEGSE
    N315            DKETTGTQVDIAQPSNVSEIKPRMKRSADVTAVSEKEVAEEAKATGTDVTNKVEVTE-SS
    NCTC8325        DKETTGTQVDIAQPSNVSEIKPRMKRSTDVTAVAEKEVVEETKATGTDVTNKVEVEEGSE
    Newman          DKETTGTQVDIAQPSNVSEIKPRMKRSTDVTAVAEKEVVEETKATGTDVTNKVEVEEGSE
    USA300_FPR3757  DKETTGTQVDIAQPSNVSEIKPRMKRSTDVTAVAEKEVVEETKATGTDVTNKVEVEEGSE
                    ***************************:*****:****.**:************* * *.

    COL             IVGHKQDTNVVNPHNAERVTLKYKWKFGEGIKAGDYFDFTLSDNVETHGISTLRKVPEIK
    N315            LEGHNKDSNIVNPHNAQRVTLKYKWKFGEGIKAGDYFDFTLSDNVETHGISTLRKVPEIK
    NCTC8325        IVGHKQDTNVVNPHNAERVTLKYKWKFGEGIKAGDYFDFTLSDNVETHGISTLRKVPEIK
    Newman          IVGHKQDTNVVNPHNAERVTLKYKWKFGEGIKAGDYFDFTLSDNVETHGISTLRKVPEIK
    USA300_FPR3757  IVGHKQDTNVVNPHNAERVTLKYKWKFGEGIKAGDYFDFTLSDNVETHGISTLRKVPEIK
                    : **::*:*:******:*******************************************

    COL             -STDGQVMATGEIIGERKVRYTFKEYVQEKKDLTAELSLNLFIDPTTVTQKGNQNVEVKL
    N315            SSTEDKVMANGQVINERTIRYTFTDYINNKKDLTAELNLNLFIDPTTVTKQGSQKVEVTL
    NCTC8325        -STDGQVMATGEIIGERKVRYTFKEYVQEKKDLTAELSLNLFIDPTTVTQKGNQNVEVKL
    Newman          -STDGQVMATGEIIGERKVRYTFKEYVQEKKDLTAELSLNLFIDPTTVTQKGNQNVEVKL
    USA300_FPR3757  -STDGQVMATGEIIGERKVRYTFKEYVQEKKDLTAELSLNLFIDPTTVTQKGNQNVEVKL
                     **:.:***.*::*.**.:****.:*:::********.***********::*.*:***.*

    COL             GETTVSKIFNIQYLGGVRDNWGVTANGRIDTLNKVDGKFSHFAYMKPNNQSLSSVTVTGQ
    N315            GQNKVSKEFDIKYLDGVKDRMGVTVNGRIDTLNKEEGKFSHFAYVKPNNQSLTSVTVTGQ
    NCTC8325        GETTVSKIFNIQYLGGVRDNWGVTANGRIDTLNKVDGKFSHFAYMKPNNQSLSSVTVTGQ
    Newman          GETTVSKIFNIQYLGGVRDNWGVTANGRIDTLNKVDGKFSHFAYMKPNNQSLSSVTVTGQ
    USA300_FPR3757  GETTVSKIFNIQYLGGVRDNWGVTANGRIDTLNKVDGKFSHFAYMKPNNQSLSSVTVTGQ
                    *:..*** *:*:**.**:*. ***.********* :********:*******:*******

    COL             VTKGNKPGVNNPTVKVYKHIGSDDLAESVYAKLDDVSKFEDVTDNMSLDFDTNGGYSLNF
    N315            VTSGYKQSANNPTVKVYKHIGSDELAESVYAKLDDTSKFEDVTEKVNLSYTSNGGYTLNL
    NCTC8325        VTKGNKPGVNNPTVKVYKHIGSDDLAESVYAKLDDVSKFEDVTDNMSLDFDTNGGYSLNF
    Newman          VTKGNKPGVNNPTVKVYKHIGSDDLAESVYAKLDDVSKFEDVTDNMSLDFDTNGGYSLNF
    USA300_FPR3757  VTKGNKPGVNNPTVKVYKHIGSDDLAESVYAKLDDVSKFEDVTDNMSLDFDTNGGYSLNF
                    **.* * ..**************:***********.*******:::.*.: :****:**:

    COL             NNLDQSKNYVIKYEGYYDSNASNLEFQTHLFGYYNY--------YYTSNLTWKNGVAFYS
    N315            GDLDNSKDYVIKYEGEYDQNAKDLNFRTHLSGYHKYYPYYPYYPYYPVQLTWNNGVAFYS
    NCTC8325        NNLDQSKNYVIKYEGYYDSNASNLEFQTHLFGYYNY--------YYTSNLTWKNGVAFYS
    Newman          NNLDQSKNYVIKYEGYYDSNASNLEFQTHLFGYYNY--------YYTSNLTWKNGVAFYS
    USA300_FPR3757  NNLDQSKNYVIKYEGYYDSNASNLEFQTHLFGYYNY--------YYTSNLTWKNGVAFYS
                    .:**:**:******* **.**.:*:*:*** **::*        **. :***:*******

    COL             NNAQGDGKDKLKEPIIEHSTPIELEFKSEPPVEKHELTGTIEESNDSKPIDFEYHTAVEG
    N315            NNAKGDGKDKPNDPIIEKSEPIDLDIKSEPPVEKHELTGTIEESNDSKPIDFEYHTAVEG
    NCTC8325        NNAQGDGKDKLKEPIIEHSTPIELEFKSEPPVEKHELTGTIEESNDSKPIDFEYHTAVEG
    Newman          NNAQGDGKDKLKEPIIEHSTPIELEFKSEPPVEKHELTGTIEESNDSKPIDFEYHTAVEG
    USA300_FPR3757  NNAQGDGKDKLKEPIIEHSTPIELEFKSEPPVEKHELTGTIEESNDSKPIDFEYHTAVEG
                    ***:****** ::****:* **:*::**********************************

    COL             AEGHAEGTIETEEDSIHVDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDED
    N315            AEGHAEGIIETEEDSIHVDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEE
    NCTC8325        AEGHAEGTIETEEDSIHVDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDED
    Newman          AEGHAEGTIETEEDSIHVDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDED
    USA300_FPR3757  AEGHAEGTIETEEDSIHVDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDED
                    ******* ***************************************************:

    COL             STKGIVTGAVSDHTTIEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSG
    N315            STKGIVTGAVSDHTTVEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSG
    NCTC8325        STKGIVTGAVSDHTTIEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSG
    Newman          STKGIVTGAVSDHTTIEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSG
    USA300_FPR3757  STKGIVTGAVSDHTTIEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSG
                    ***************:********************************************

    COL             LGTENGHGNYGVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVD
    N315            LGTENGHGNYGVIDEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVD
    NCTC8325        LGTENGHGNYGVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVD
    Newman          LGTENGHGNYGVIEEIEENSHVDIKSELG-------------------------------
    USA300_FPR3757  LGTENGHGNYGVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVD
                    *************:***************                               

    COL             IDFDSVPQIHGQNNGNQSFEEDTEKDKPKYEQGGNIIDIDFDSVPHIHGFNKHTEIIEED
    N315            IDFDSVPQIHGQNNGNQSFEEDTEEDKPKYEQGGNIIDIDFDSVPQIHGFNKHNEIIEED
    NCTC8325        IDFDSVPQIHGQNNGNQSFEEDTEKDKPKYEQGGNIIDIDFDSVPHIHGFNKHTEIIEED
    Newman          ------------------------------------------------------------
    USA300_FPR3757  IDFDSVPQIHGQNNGNQSFEEDTEKDKPKYEQGGNIIDIDFDSVPHIHGFNKHTEIIEED
                                                                                

    COL             TNKDKPNYQFGGHNSVDFEEDTLPQVSGHNEGQQTIEEDTTPPIVP----------PTPP
    N315            TNKDKPNYQFGGHNSVDFEEDTLPKVSGQNEGQQTIEEDTTPPTPPTPEVPSEPETPTPP
    NCTC8325        TNKDKPNYQFGGHNSVDFEEDTLPQVSGHNEGQQTIEEDTTPPIVP----------PTPP
    Newman          ------------------------------------------------------------
    USA300_FPR3757  TNKDKPNYQFGGHNSVDFEEDTLPQVSGHNEGQQTIEEDTTPPIVP----------PTPP
                                                                                

    COL             TPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPTEPGKPIPPAKEEPKKPSKPVEQGKVV
    N315            TPEVPSEPGEPTPPKPEVPSEPETPVPPTPEVPSEPGKPVPPAKEEPKKPSKPVEQGKVV
    NCTC8325        TPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPTEPGKPIPPAKEEPKKPSKPVEQGKVV
    Newman          ------------------------------------------------------------
    USA300_FPR3757  TPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPTEPGKPIPPAKEEPKKPSKPVEQGKVV
                                                                                

    COL             TPVIEINEKVKAVVPTKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALLRRNKKNH
    N315            TPVIEINEKVKAVAPTKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLLRRNKKNN
    NCTC8325        TPVIEINEKVKAVVPTKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALLRRNKKNH
    Newman          ------------------------------------------------------------
    USA300_FPR3757  TPVIEINEKVKAVVPTKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALLRRNKKNH
                                                                                

    COL             KA
    N315            KA
    NCTC8325        KA
    Newman          --
    USA300_FPR3757  KA