From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006130000
  • symbol?: gntP
  • description?: gluconate permease

      descriptions from strain specific annotations:

    • gluconate permease
    • gluconate transporter, permease protein
    • putative gluconate permease
    • high-affinity gluconate transporter
    • GntP family gluconate:proton (H+) symporter
    • gluconate:H+ symporter family transporter GntP
    • gluconate permease, Bsu4004-like protein
    • transporter, gluconate:H+ symporter (GntP) family
  • strand?: -
  • coordinates?: 6204873..6206231
  • synteny block?: BlockID0048620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2514 (gntP)
    N315:
    SA2293 (gntP)
    NCTC8325:
    Newman:
    NWMN_2401 (gntP)
    USA300_FPR3757:
    04-02981:
    SA2981_2441 (gntP)
    08BA02176:
    C248_2557 (gntP)
    11819-97:
    MS7_2508 (gntT)
    71193:
    ST398NM01_2555
    ECT-R 2:
    ECTR2_2357
    ED133:
    SAOV_2546c
    ED98:
    SAAV_2570 (gntP)
    HO 5096 0412:
    SAEMRSA15_24010 (gntP)
    JH1:
    SaurJH1_2580
    JH9:
    SaurJH9_2528
    JKD6008:
    SAA6008_02540 (gntP)
    JKD6159:
    SAA6159_02399 (gntP)
    LGA251:
    SARLGA251_22780 (gntP)
    M013:
    M013TW_2470
    MRSA252:
    SAR2582 (gntP)
    MSHR1132:
    SAMSHR1132_23230
    MSSA476:
    SAS2390
    Mu3:
    SAHV_2489 (gntP)
    Mu50:
    SAV2505 (gntP)
    MW2:
    MW2423 (gntP)
    RF122:
    SAB2377c (gntP)
    ST398:
    SAPIG2555
    T0131:
    SAT0131_02703 (rpsO)
    TCH60:
    HMPREF0772_10692 (gntP)
    TW20:
    SATW20_26240 (gntP)
    USA300_TCH1516:
    USA300HOU_2492 (gntP)
    VC40:
    SAVC_11390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFNEIWPLISVVLGIVILLVLIIGFKLNTFISLIITSMITALMLGIPLTKIMETIEKGMG
    N315            MFNEIWPLISVVLGIVILLVLIIGFKLNTFISLIITSMITALMLGIPLTKIMETIEKGMG
    NCTC8325        MFNEIWPLISVVLGIVILLVLIIGFKLNTFISLIITSMITALMLGIPLTKIMETIEKGMG
    Newman          MFNEIWPLISVVLGIVILLVLIIGFKLNTFISLIITSMITALMLGIPLTKIMETIEKGMG
    USA300_FPR3757  MFNEIWPLISVVLGIVILLVLIIGFKLNTFISLIITSMITALMLGIPLTKIMETIEKGMG
                    ************************************************************

    COL             STLGHIALIFGLGAILGKLLADGGGATRIADTLIQKFGQKHVQWAMLVAAFIVGIALFFE
    N315            STLGHIALIFGLGAILGKLLADGGGATRIADTLIQKFGQKHVQWAMLVAAFIVGIALFFE
    NCTC8325        STLGHIALIFGLGAILGKLLADGGGATRIADTLIQKFGQKHVQWAMLVAAFIVGIALFFE
    Newman          STLGHIALIFGLGAILGKLLADGGGATRIADTLIQKFGQKHVQWAMLVAAFIVGIALFFE
    USA300_FPR3757  STLGHIALIFGLGAILGKLLADGGGATRIADTLIQKFGQKHVQWAMLVAAFIVGIALFFE
                    ************************************************************

    COL             VGLVLLIPLVFTVAKRANVSVLKLGLPMVTALSVTHGFLPPHPGPVVIAKELKANVGDVL
    N315            VGLVLLIPLVFTVAKRANVSVLKLGLPMVTALSVTHGFLPPHPGPVVIAKELKANVGDVL
    NCTC8325        VGLVLLIPLVFTVAKRANVSVLKLGLPMVTALSVTHGFLPPHPGPVVIAKELKANVGDVL
    Newman          VGLVLLIPLVFTVAKRANVSVLKLGLPMVTALSVTHGFLPPHPGPVVIAKELKANVGDVL
    USA300_FPR3757  VGLVLLIPLVFTVAKRANVSVLKLGLPMVTALSVTHGFLPPHPGPVVIAKELKANVGDVL
                    ************************************************************

    COL             LYGMIIAIPVTLIAGPIFNKVAQKMIPSAYTREGDISALGAQKEFTDQEMPGFGMSLLTA
    N315            LYGMIIAIPVTLIAGPIFNKVAQKMIPSAYTREGDISALGAQKEFTDQEMPGFGMSLLTA
    NCTC8325        LYGMIIAIPVTLIAGPIFNKVAQKMIPSAYTREGDISALGAQKEFTDQEMPGFGMSLLTA
    Newman          LYGMIIAIPVTLIAGPIFNKVAQKMIPSAYTREGDISALGAQKEFTDQEMPGFGMSLLTA
    USA300_FPR3757  LYGMIIAIPVTLIAGPIFNKVAQKMIPSAYTREGDISALGAQKEFTDQEMPGFGMSLLTA
                    ************************************************************

    COL             TLPVILMLVSTITQLVTGHDKPTNLFESIIYMIGTAGTAMLIAVLFAIVTMGLMRKRKMN
    N315            TLPVILMLVSTITQLVTGHDKPTNLFESIIYMIGTAGTAMLIAVLFAIVTMGLMRKRKMN
    NCTC8325        TLPVILMLVSTITQLVTGHDKPTNLFESIIYMIGTAGTAMLIAVLFAIVTMGLMRKRKMN
    Newman          TLPVILMLVSTITQLVTGHDKPTNLFESIIYMIGTAGTAMLIAVLFAIVTMGLMRKRKMN
    USA300_FPR3757  TLPVILMLVSTITQLVTGHDKPTNLFESIIYMIGTAGTAMLIAVLFAIVTMGLMRKRKMN
                    ************************************************************

    COL             HIMESVTNAIYPIGMMLLIIGGGGTFKQVLIDGGVGNTIAKMFEGTEMSPILLAWIVAAV
    N315            HIMESVTNAIYPIGMMLLIIGGGGTFKQVLIDGGVGNTIAKMFEGTEMSPILLAWIVAAV
    NCTC8325        HIMESVTNAIYPIGMMLLIIGGGGTFKQVLIDGGVGNTIAKMFEGTEMSPILLAWIVAAV
    Newman          HIMESVTNAIYPIGMMLLIIGGGGTFKQVLIDGGVGNTIAKMFEGTEMSPILLAWIVAAV
    USA300_FPR3757  HIMESVTNAIYPIGMMLLIIGGGGTFKQVLIDGGVGNTIAKMFEGTEMSPILLAWIVAAV
                    ************************************************************

    COL             LRIALGSATVAAISTTGIVLPLLQSSDVNVALVVLAIGAGSVILSHVNDAGFWMFKEYFG
    N315            LRIALGSATVAAISTTGIVLPLLQSSDVNVALVVLAIGAGSVILSHVNDAGFWMFKEYFG
    NCTC8325        LRIALGSATVAAISTTGIVLPLLQSSDVNVALVVLAIGAGSVILSHVNDAGFWMFKEYFG
    Newman          LRIALGSATVAAISTTGIVLPLLQSSDVNVALVVLAIGAGSVILSHVNDAGFWMFKEYFG
    USA300_FPR3757  LRIALGSATVAAISTTGIVLPLLQSSDVNVALVVLAIGAGSVILSHVNDAGFWMFKEYFG
                    ************************************************************

    COL             LTVKETFLTWSLLETIISVSGIIFILFISLFV
    N315            LTVKETFLTWSLLETIISVSGIIFILFISLFV
    NCTC8325        LTVKETFLTWSLLETIISVSGIIFILFISLFV
    Newman          LTVKETFLTWSLLETIISVSGIIFILFISLFV
    USA300_FPR3757  LTVKETFLTWSLLETIISVSGIIFILFISLFV
                    ********************************