From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006261000
  • symbol?:
  • description?: ferrous iron transporter B

      descriptions from strain specific annotations:

    • ferrous iron transporter B
    • transporter gate domain-containing protein
    • FeoB family ferrous iron (Fe2+) uptake protein
    • FeoB family ferrous iron uptake protein
    • ferrous iron transporter protein B
    • ferrous iron transport protein B
    • membrane protein
    • nucleoside recognition domain-containing protein
    • nucleoside recognition family protein
    • putative FeoB family ferrous iron (Fe2+) uptake protein
    • putative ferrous iron transporter protein B
  • strand?: -
  • coordinates?: 6315212..6316531
  • synteny block?: BlockID0049840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2521
    08BA02176:
    C248_2642
    11819-97:
    MS7_2589
    71193:
    ST398NM01_2633
    ECT-R 2:
    ECTR2_2437
    ED133:
    SAOV_2628c
    ED98:
    SAAV_2649
    HO 5096 0412:
    SAEMRSA15_24860
    JH1:
    SaurJH1_2659
    JH9:
    SaurJH9_2605
    JKD6008:
    SAA6008_02621
    JKD6159:
    SAA6159_02480
    LGA251:
    SARLGA251_23570
    M013:
    M013TW_2557
    MRSA252:
    SAR2663
    MSHR1132:
    SAMSHR1132_23980
    MSSA476:
    SAS2469
    Mu3:
    SAHV_2567
    Mu50:
    SAV2583
    MW2:
    MW2503
    RF122:
    SAB2457c
    ST398:
    SAPIG2633
    T0131:
    SAT0131_02795
    TCH60:
    HMPREF0772_10608
    TW20:
    SATW20_27040
    USA300_TCH1516:
    USA300HOU_2577
    VC40:
    SAVC_11786

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------MRTGHYTPIPNEPHYLVISHADKLTATEKAKLRLLIIKQKLDISLAESVVSSP
    N315            MLEVKYDMRTGHYTPIPHEPHYLVISHADKLTATEKAKLRLLIIKQKLDISLAESVVSSP
    Newman          MLEVKYDMRTGHYTPIPNEPHYLVISHADKLTATEKAKLRLLIIKQKLDISLAESVVSSP
    USA300_FPR3757  -------MRTGHYTPIPNEPHYLVISHADKLTATEKAKLRLLIIKQKLDISLAESVVSSP
                           **********:******************************************

    COL             IASEHVIEQLTLFQHERRHLRPKISATFLAWLLIFLMFALPIGIAYQFSDWFQNQYVSAW
    N315            IASEHVIEQLTLFQHERRHLRPKISATFLAWLLIFLMFALPIGIAYQFSDWFQNQYVSAW
    Newman          IASEHVIEQLTLFQHERRHLRPKISATFLAWLLIFLMFALPIGIAYQFSDWFQNQYVSAW
    USA300_FPR3757  IASEHVIEQLTLFQHERRHLRPKISATFLAWLLIFLMFALPIGIAYQFSDWFQNQYVSAW
                    ************************************************************

    COL             IEYLTQTTLLNHDILQHILFGDYGVLSLGTYSLVWALPVVILISLSTAIIDQTGLKSWMI
    N315            IEYLTQTTLLNHDILQHILFGDYGVLSLGTYSLVWALPVVILISLSTAIIDQTGLKSWMI
    Newman          IEYLTQTTLLNHDILQHILFGDYGVLSLGTYSLVWALPVVILISLSTAIIDQTGLKSWMI
    USA300_FPR3757  IEYLTQTTLLNHDILQHILFGDYGVLSLGTYSLVWALPVVILISLSTAIIDQTGLKSWMI
                    ************************************************************

    COL             WAIEPSMLWIGLQGNDIVPLLEGFGCNAAAISQAAHQCHTCTKTQCMSLISFGSSCSYQI
    N315            WAIEPSMLWIGLQGNDIVPLLEGFGCNAAAISQAAHQCHTCTKTQCMSLISFGSSCSYQI
    Newman          WAIEPSMLWIGLQGNDIVPLLEGFGCNAAAISQAAHQCHTCTKTQCMSLISFGSSCSYQI
    USA300_FPR3757  WAIEPSMLWIGLQGNDIVPLLEGFGCNAAAISQAAHQCHTCTKTQCMSLISFGSSCSYQI
                    ************************************************************

    COL             GATLSIFSVAGKSWLFMPYLILVLLGGILHNRIWLKKNDQQLSVPLPYDRQLHMPNIRQM
    N315            GATLSIFSVAGKSWLFMPYLILVLLGGILHNRIWLKKNDQQLSVPLPYDRQLHMPNIRQM
    Newman          GATLSIFSVAGKSWLFMPYLILVLLGGILHNRIWLKKNDQQLSVPLPYDRQLHMPNIRQM
    USA300_FPR3757  GATLSIFSVAGKSWLFMPYLILVLLGGILHNRIWLKKNDQQLSVPLPYDRQLHMPNIRQM
                    ************************************************************

    COL             LLQMWQNIQMFIVQALPIFITICLIVSILSLTPILNVLSQIFTPILSLLGISSELSPGIL
    N315            LLQMWQNIQMFIVQALPIFITICLIVSILSLTPILNVLSQIFTPILSLLGISSELSPGIL
    Newman          LLQMWQNIQMFIVQALPIFITICLIVSILSLTPILNVLSQIFTPILSLLGISSELSPGIL
    USA300_FPR3757  LLQMWQNIQMFIVQALPIFITICLIVSILSLTPILNVLSQIFTPILSLLGISSELSPGIL
                    ************************************************************

    COL             FSMIRKDGMLLFNLHQGALLQGMTATQLLLLVFFSSTFTACSVTMTMLLKHLGGQSALKL
    N315            FSMIRKDGMLLFNLHQGALLQGMTATQLLLLVFFSSTFTACSVTMTMLLKHLGGQSALKL
    Newman          FSMIRKDGMLLFNLHQGALLQGMTATQLLLLVFFSSTFTACSVTMTMLLKHLGGQSALKL
    USA300_FPR3757  FSMIRKDGMLLFNLHQGALLQGMTATQLLLLVFFSSTFTACSVTMTMLLKHLGGQSALKL
                    ************************************************************

    COL             IGKQMVTSLSLVIGVGIIVKIVMLII
    N315            IGKQMVTSLSLVIGVGIIVKIVMLII
    Newman          IGKQMVTSLSLVIGVGIIVKIVMLII
    USA300_FPR3757  IGKQMVTSLSLVIGVGIIVKIVMLII
                    **************************