From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006262000
  • symbol?:
  • description?: monooxygenase

      descriptions from strain specific annotations:

    • monooxygenase
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • Thioredoxin reductase
    • FAD-dependent pyridine nucleotide-disulfide oxidoreductase
    • NAD-binding site protein
    • Oxidoreductase
  • strand?: -
  • coordinates?: 6316546..6317652
  • synteny block?: BlockID0049850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2522
    08BA02176:
    C248_2643
    11819-97:
    MS7_2590
    71193:
    ST398NM01_2634
    ECT-R 2:
    ECTR2_2438
    ED133:
    SAOV_2629c
    ED98:
    SAAV_2650
    HO 5096 0412:
    SAEMRSA15_24870
    JH1:
    SaurJH1_2660
    JH9:
    SaurJH9_2606
    JKD6008:
    SAA6008_02622
    JKD6159:
    SAA6159_02481
    LGA251:
    SARLGA251_23580
    M013:
    M013TW_2558
    MRSA252:
    SAR2664
    MSHR1132:
    SAMSHR1132_23990
    MSSA476:
    SAS2470
    Mu3:
    SAHV_2568
    Mu50:
    SAV2584
    MW2:
    MW2504
    RF122:
    SAB2458c
    ST398:
    SAPIG2634
    T0131:
    SAT0131_02796
    TCH60:
    HMPREF0772_10607
    TW20:
    SATW20_27050
    USA300_TCH1516:
    USA300HOU_2578
    VC40:
    SAVC_11800

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQHHKVAIIGAGAAGIGMAITLKDFGITDVIILEKGTVGHSFKHWPKSTRTITPSFTSNG
    N315            MQHHKVAIIGAGAAGIGMAITLKDFGITDVIILEKGTVGHSFKHWPKSTRTITPSFTSNG
    NCTC8325        MQHHKVAIIGAGAAGIGMAITLKDFGITDVIILEKGTVGHSFKHWPKSTRTITPSFTSNG
    Newman          MQHHKVAIIGAGAAGIGMAITLKDFGITDVIILEKGTVGHSFKHWPKSTRTITPSFTSNG
    USA300_FPR3757  MQHHKVAIIGAGAAGIGMAITLKDFGITDVIILEKGTVGHSFKHWPKSTRTITPSFTSNG
                    ************************************************************

    COL             FGMPDMNAISMDTSPAFTFNEEHISGETYAEYLQVVANHYELNIFENTVVTNISVDDAYY
    N315            FGMPDMNAISMDTSPAFTFNEEHISGETYAEYLQVVANHYELNIFENTVVTNISADDAYY
    NCTC8325        FGMPDMNAISMDTSPAFTFNEEHISGETYAEYLQVVANHYELNIFENTVVTNISVDDAYY
    Newman          FGMPDMNAISMDTSPAFTFNEEHISGETYAEYLQVVANHYELNIFENTVVTNISVDDAYY
    USA300_FPR3757  FGMPDMNAISMDTSPAFTFNEEHISGETYAEYLQVVANHYELNIFENTVVTNISVDDAYY
                    ******************************************************.*****

    COL             TIATTTEIYHADYIFVATGDYNFPKKPFKYGIHYSEIEDFDNFNKGQYVVIGGNESGFDA
    N315            TIATTTETYHADYIFVATGDYNFPKKPFKYGIHYSEIEDFDNFNKGQYVVIGGNESGFDA
    NCTC8325        TIATTTEIYHADYIFVATGDYNFPKKPFKYGIHYSEIEDFDNFNKGQYVVIGGNESGFDA
    Newman          TIATTTEIYHADYIFVATGDYNFPKKPFKYGIHYSEIEDFDNFNKGQYVVIGGNESGFDA
    USA300_FPR3757  TIATTTEIYHADYIFVATGDYNFPKKPFKYGIHYSEIEDFDNFNKGQYVVIGGNESGFDA
                    ******* ****************************************************

    COL             AYQLAKNGSDIALYTSTTGLNDPDADPSVRLSPYTRQRLGNVIKQGARIEMNVHYTVKDI
    N315            AYQLAKNGSDIALYTSTTGLNDPDADPSVRLSPYTRQRLGNVIKQGARIEMNVHYTVKDI
    NCTC8325        AYQLAKNGSDIALYTSTTGLNDPDADPSVRLSPYTRQRLGNVIKQGARIEMNVHYTVKDI
    Newman          AYQLAKNGSDIALYTSTTGLNDPDADPSVRLSPYTRQRLGNVIKQGARIEMNVHYTVKDI
    USA300_FPR3757  AYQLAKNGSDIALYTSTTGLNDPDADPSVRLSPYTRQRLGNVIKQGARIEMNVHYTVKDI
                    ************************************************************

    COL             DFNNGQYHISFDSGQSVLTPHEPILATGFDATKNPIVQQLFVTTNQDIKLTTHDESTRYP
    N315            DFNNGQYHISFDSGQSVHTPHEPILATGFDATKNPIVQQLFVTTNQDIKLTTHDESTRYP
    NCTC8325        DFNNGQYHISFDSGQSVLTPHEPILATGFDATKNPIVQQLFVTTNQDIKLTTHDESTRYP
    Newman          DFNNGQYHISFDSGQSVLTPHEPILATGFDATKNPIVQQLFVTTNQDIKLTTHDESTRYP
    USA300_FPR3757  DFNNGQYHISFDSGQSVLTPHEPILATGFDATKNPIVQQLFVTTNQDIKLTTHDESTRYP
                    ***************** ******************************************

    COL             NIFMIGATVENDNAKLCYIYKFRARFAVLAHLLTQREGLPAKQDVIENYQKNQMYLDDYS
    N315            NIFMIGATVENDNAKLCYIYKFRARFAVLAHLLTQREGLPAKQEVIENYQKNQMYLDDYS
    NCTC8325        NIFMIGATVENDNAKLCYIYKFRARFAVLAHLLTQREGLPAKQDVIENYQKNQMYLDDYS
    Newman          NIFMIGATVENDNAKLCYIYKFRARFAVLAHLLTQREGLPAKQDVIENYQKNQMYLDDYS
    USA300_FPR3757  NIFMIGATVENDNAKLCYIYKFRARFAVLAHLLTQREGLPAKQDVIENYQKNQMYLDDYS
                    *******************************************:****************

    COL             CCEVSCTC
    N315            CCEVSCTC
    NCTC8325        CCEVSCTC
    Newman          CCEVSCTC
    USA300_FPR3757  CCEVSCTC
                    ********