From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006278000
  • symbol?:
  • description?: acyl esterase

      descriptions from strain specific annotations:

    • acyl esterase
    • CocE/NonD family hydrolase
    • acyl esterase/dipeptidyl-peptidase
    • hydrolase, CocE/NonD family
    • hydrolase CocE/NonD family protein
    • putative acyl esterase/dipeptidyl-peptidase
    • S15 family peptidase
    • Xaa-Pro dipeptidyl-peptidase
    • X-Pro dipeptidyl-peptidase (S15) family protein
    • X-Pro dipeptidyl-peptidase domain-containing protein
  • strand?: +
  • coordinates?: 6326577..6328322
  • synteny block?: BlockID0050010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2532
    08BA02176:
    C248_2655
    11819-97:
    MS7_2600
    71193:
    ST398NM01_2644
    ECT-R 2:
    ECTR2_2448
    ED133:
    SAOV_2639
    ED98:
    SAAV_2660
    HO 5096 0412:
    SAEMRSA15_24970
    JH1:
    SaurJH1_2670
    JH9:
    SaurJH9_2616
    JKD6008:
    SAA6008_02653 (pepX)
    JKD6159:
    SAA6159_02491 (pepX)
    LGA251:
    SARLGA251_23680
    M013:
    M013TW_2568
    MRSA252:
    SAR2674
    MSHR1132:
    SAMSHR1132_24100
    MSSA476:
    SAS2480
    Mu3:
    SAHV_2578
    Mu50:
    SAV2594
    MW2:
    MW2514
    RF122:
    SAB2469
    ST398:
    SAPIG2644
    T0131:
    SAT0131_02828 (hisG)
    TCH60:
    HMPREF0772_10596
    TW20:
    SATW20_27350
    USA300_TCH1516:
    USA300HOU_2590
    VC40:
    SAVC_11850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFR
    N315            MNQHLLGNPKLTVTHVNEVKTGINHIVVDSVQYGNQEMIMEKDVTVEMRDGEKLYINIFR
    NCTC8325        MNQHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDVTVEMRDGEKLYINIFR
    Newman          MNQHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFR
    USA300_FPR3757  MNQHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDVTVEMRDGEKLYINIFR
                    ********************:********************** ****************

    COL             PNKDGKFPVVMSADTYGKDNKPKITNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVV
    N315            PNKDGKFPVVMSADTYGKDNKPKITNMGALWPTLGAIPTSSFTPEESPDPGFWVPNDYVV
    NCTC8325        PNKDGKFPVVMSADTYGKDNKPKITNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVV
    Newman          PNKDGKFPVVMSADTYGKDNKPKITNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVV
    USA300_FPR3757  PNKDGKFPVVMSADTYGKDNKPKITNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVV
                    ***********************************:************************

    COL             VKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVAS
    N315            VKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAAKQPWSNGNIGTNGVSYLAVTQWWVAS
    NCTC8325        VKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVAS
    Newman          VKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVAS
    USA300_FPR3757  VKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVAS
                    **********************************:*.***********************

    COL             LNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQE
    N315            LNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWIQGIFARWTDNPNIEDMIQAQQE
    NCTC8325        LNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQE
    Newman          LNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQE
    USA300_FPR3757  LNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQE
                    ************************************* ***************:******

    COL             HPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEW
    N315            HPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEW
    NCTC8325        HPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEW
    Newman          HPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEW
    USA300_FPR3757  HPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEW
                    ************************************************************

    COL             ESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYT
    N315            ESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNTEYT
    NCTC8325        ESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYT
    Newman          ESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYT
    USA300_FPR3757  ESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYT
                    ********************************************************:***

    COL             PLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDS
    N315            PLYLNAENHTLNHAKISSAYVAQYDSEDKRQDVSFKYTFDKDTELVGNMNLKLWVSTTDS
    NCTC8325        PLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDS
    Newman          PLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDS
    USA300_FPR3757  PLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDS
                    *******************:*********:***************************.**

    COL             DDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHET
    N315            DDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSTIAQPWHKHET
    NCTC8325        DDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHET
    Newman          DDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHET
    USA300_FPR3757  DDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHET
                    *************************************************:**********

    COL             ELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKG
    N315            ELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETINNG
    NCTC8325        ELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKG
    Newman          ELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKG
    USA300_FPR3757  ELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKG
                    ********************************************************:*:*

    COL             MHMIYTGGKYDSQLIIPIVN
    N315            MHMIYTGGKYDSQLIIPIVN
    NCTC8325        MHMIYTGGKYDSQLIIPIVN
    Newman          MHMIYTGGKYDSQLIIPIVN
    USA300_FPR3757  MHMIYTGGKYDSQLIIPIVN
                    ********************