From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006301000
  • symbol?:
  • description?: 4-aminobutyrate aminotransferase

      descriptions from strain specific annotations:

    • 4-aminobutyrate aminotransferase
    • aspartate aminotransferase family protein
    • 4-aminobutyrate transaminase
    • Aminotransferase
    • aminotransferase class-III family protein
    • pseudogene
    • putative aminotransferase
  • strand?: -
  • coordinates?: 6348163..6349500
  • synteny block?: BlockID0050170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2542
    08BA02176:
    C248_2663
    11819-97:
    MS7_2609
    71193:
    ST398NM01_2652
    ECT-R 2:
    ECTR2_2458
    ED133:
    SAOV_2648c
    ED98:
    SAAV_2670
    HO 5096 0412:
    SAEMRSA15_25080
    JH1:
    SaurJH1_2680
    JH9:
    SaurJH9_2626
    JKD6008:
    SAA6008_02661
    JKD6159:
    SAA6159_02500
    LGA251:
    SARLGA251_23770
    M013:
    M013TW_2582
    MRSA252:
    SAR2682
    MSHR1132:
    SAMSHR1132_24190
    MSSA476:
    SAS2489
    Mu3:
    SAHV_2588
    Mu50:
    SAV2604
    MW2:
    MW2523
    RF122:
    SAB2477c
    ST398:
    SAPIG2652
    T0131:
    SAT0131_02836
    TCH60:
    HMPREF0772_10588 (gabT)
    TW20:
    SATW20_27430
    USA300_TCH1516:
    USA300HOU_2596
    VC40:
    SAVC_11890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------MSKAHQLIQEDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLL
    N315            MHINTVNGRGMYMSKAHQLIQEDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLL
    NCTC8325        ------------MSKAHQLIQEDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLL
    Newman          MHINTVNGRGMYMSKAHQLIQEDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLL
    USA300_FPR3757  MHINTVNGRGMYMSKAHQLIQEDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLL
                                ************************************************

    COL             SSASSQNVGHAPREVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCEIAPGDFEKRVTF
    N315            SSASSQNVGHAPREVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCELAPGDFEKRVTF
    NCTC8325        SSASSQNVGHAPREVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCEIAPGDFEKRVTF
    Newman          SSASSQNVGHAPREVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCEIAPGDFEKRVTF
    USA300_FPR3757  SSASSQNVGHAPREVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCEIAPGDFEKRVTF
                    ************************************************:***********

    COL             GLTGSDANDGIIKFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFY
    N315            GLTGSDANDGIIKFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFY
    NCTC8325        GLTGSDANDGIIKFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFY
    Newman          GLTGSDANDGIIKFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFY
    USA300_FPR3757  GLTGSDANDGIIKFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFY
                    ************************************************************

    COL             HIPFPDKYRGMYEQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPG
    N315            HIPFPDKYRGMYEQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPG
    NCTC8325        HIPFPDKYRGMYEQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPG
    Newman          HIPFPDKYRGMYEQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPG
    USA300_FPR3757  HIPFPDKYRGMYEQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPG
                    ************************************************************

    COL             YFEALEKICREHGILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIV
    N315            YFEALEKICREHGILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIV
    NCTC8325        YFEALEKICREHGILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIV
    Newman          YFEALEKICREHGILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIV
    USA300_FPR3757  YFEALEKICREHGILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIV
                    ************************************************************

    COL             GRKEIMNCLEAPAHLFTTGANPVSCEAALATIQMIEDQSLLQASAEKGEYVRKRMDQWVS
    N315            GRKEIMNCLEAPAHLFTTGANPVSCEAALATIQMIEDQSLLQASAEKGEYVRKRMDQWVS
    NCTC8325        GRKEIMNCLEAPAHLFTTGANPVSCEAALATIQMIEDQSLLQASAEKGEYVRKRMDQWVS
    Newman          GRKEIMNCLEAPAHLFTTGANPVSCEAALATIQMIEDQSLLQASAEKGEYVRKRMDQWVS
    USA300_FPR3757  GRKEIMNCLEAPAHLFTTGANPVSCEAALATIQMIEDQSLLQASAEKGEYVRKRMDQWVS
                    ************************************************************

    COL             KYNSVGDVRGKGLSIGIDIVSDKKLKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPP
    N315            KYNSVGDVRGKGLSIGIDIVSDKKLKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPP
    NCTC8325        KYNSVGDVRGKGLSIGIDIVSDKKLKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPP
    Newman          KYNSVGDVRGKGLSIGIDIVSDKKLKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPP
    USA300_FPR3757  KYNSVGDVRGKGLSIGIDIVSDKKLKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPP
                    ************************************************************

    COL             LVITYEQLDTALNTIEDALTALEAGNLDQYDISGQGW
    N315            LVITYEQLDTALNTIEDALTALEAGNLDQYDISGQGW
    NCTC8325        LVITYEQLDTALNTIEDALTALEAGNLDQYDISGQGW
    Newman          LVITYEQLDTALNTIEDALTALEAGNLDQYDISGQGW
    USA300_FPR3757  LVITYEQLDTALNTIEDALTALEAGNLDQYDISGQGW
                    *************************************