From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006323000
  • symbol?: citM
  • description?: magnesium citrate secondary transporter

      descriptions from strain specific annotations:

    • magnesium citrate secondary transporter
    • citrate transporter family protein
    • CitMHS family citrate/H+ symporter
    • citrate transporter, permease protein
    • CitMHS family citrate-magnesium (Mg2+):proton (H+) citrate-calcium (Ca2+):proton (H+) symporter
    • transporter protein
    • putative transporter protein
    • citrate/H+ symporter, CitMHS family
  • strand?: -
  • coordinates?: 6367090..6368460
  • synteny block?: BlockID0050390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2556
    08BA02176:
    C248_2680
    11819-97:
    MS7_2623
    71193:
    ST398NM01_2665
    ECT-R 2:
    ECTR2_2472
    ED133:
    SAOV_2664c
    ED98:
    SAAV_2684
    HO 5096 0412:
    SAEMRSA15_25220
    JH1:
    SaurJH1_2695
    JH9:
    SaurJH9_2641
    JKD6008:
    SAA6008_02675 (citM)
    JKD6159:
    SAA6159_02514 (citM)
    LGA251:
    SARLGA251_23900
    M013:
    M013TW_2596
    MRSA252:
    SAR2696
    MSHR1132:
    SAMSHR1132_24340
    MSSA476:
    SAS2504
    Mu3:
    SAHV_2602
    Mu50:
    SAV2618
    MW2:
    MW2538
    RF122:
    SAB2492c
    ST398:
    SAPIG2665
    T0131:
    SAT0131_02852
    TCH60:
    HMPREF0772_10572
    TW20:
    SATW20_27560
    USA300_TCH1516:
    USA300HOU_2615 (citM)
    VC40:
    SAVC_11955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNSDNMWLTVMGLIIIISIVGLLIAKKINPVVGMTIIPCLGAMILGYSVTDLVGFFAKGL
    N315            MNSDNMWLTVMGLIIIISIVGLLIAKKINPVVGMTIIPCLGAMILGYSVTDLVGFFAKGL
    NCTC8325        MNSDNMWLTVMGLIIIISIVGLLIAKKINPVVGMTIIPCLGAMILGYSVTDLVGFFAKGL
    Newman          MNSDNMWLTVMGLIIIISIVGLLIAKKINPVVGMTIIPCLGAMILGYSVTDLVGFFAKGL
    USA300_FPR3757  MNSDNMWLTVMGLIIIISIVGLLIAKKINPVVGMTIIPCLGAMILGYSVTDLVGFFAKGL
                    ************************************************************

    COL             DQVINVVIMFIFAIIFFGIMNDSGLFKPLVKRLILMTRGNVVIVCAMTALIGTIAQLDGA
    N315            DQVINVVIMFIFAIIFFGIMNDSGLFKPLVKRLILMTRGNVVIVCAMTALIGTIAQLDGA
    NCTC8325        DQVINVVIMFIFAIIFFGIMNDSGLFKPLVKRLILMTRGNVVIVCAMTALIGTIAQLDGA
    Newman          DQVINVVIMFIFAIIFFGIMNDSGLFKPLVKRLILMTRGNVVIVCAMTALIGTIAQLDGA
    USA300_FPR3757  DQVINVVIMFIFAIIFFGIMNDSGLFKPLVKRLILMTRGNVVIVCAMTALIGTIAQLDGA
                    ************************************************************

    COL             GAVTFLLSIPALLPLYKALNMNKYLLILLLALSAAIMNMVPWGGPMARVAAVLKAKSVNE
    N315            GAVTFLLSIPALLPLYKALNMNKYLLILLLALSAAIMNMVPWGGPMARVAAVLKAKSVNE
    NCTC8325        GAVTFLLSIPALLPLYKALNMNKYLLILLLALSAAIMNMVPWGGPMARVAAVLKAKSVNE
    Newman          GAVTFLLSIPALLPLYKALNMNKYLLILLLALSAAIMNMVPWGGPMARVAAVLKAKSVNE
    USA300_FPR3757  GAVTFLLSIPALLPLYKALNMNKYLLILLLALSAAIMNMVPWGGPMARVAAVLKAKSVNE
                    ************************************************************

    COL             LWYGLIPIQIIGFILVMLFAVYLGFKEQKRIKKAIERNELPQTQDIDVHKLVEVYERDQD
    N315            LWYGLIPIQIIGFILVMLFAVYLGFKEQKRIKKAIERNELPQTQDIDVHKLVEVYERDQD
    NCTC8325        LWYGLIPIQIIGFILVMLFAVYLGFKEQKRIKKAIERNELPQTQDIDVHKLVEVYERDQD
    Newman          LWYGLIPIQIIGFILVMLFAVYLGFKEQKRIKKAIERNELPQTQDIDVHKLVEVYERDQD
    USA300_FPR3757  LWYGLIPIQIIGFILVMLFAVYLGFKEQKRIKKAIERNELPQTQDIDVHKLVEVYERDQD
                    ************************************************************

    COL             VRFPVKGRARTKSWIKWVNTALTLAVILSMLINIAPPEFAFMIGVSLALVINFKSVDEQM
    N315            VRFPVKGRARTKSWIKWVNTALTLAVILSMLINIAPPEFAFMIGVSLALVINFKSVDEQM
    NCTC8325        VRFPVKGRARTKSWIKWVNTALTLAVILSMLINIAPPEFAFMIGVSLALVINFKSVDEQM
    Newman          VRFPVKGRARTKSWIKWVNTALTLAVILSMLINIAPPEFAFMIGVSLALVINFKSVDEQM
    USA300_FPR3757  VRFPVKGRARTKSWIKWVNTALTLAVILSMLINIAPPEFAFMIGVSLALVINFKSVDEQM
                    ************************************************************

    COL             ERLRAHAPNALMMAAVIIAAGMFLGVLNETGMLKAIATNLIKVIPAEVGPYLHIIVGLLG
    N315            ERLRAHAPNALMMAAVIIAAGMFLGVLNETGMLKAIATNLIKVIPAEVGPYLHIIVGLLG
    NCTC8325        ERLRAHAPNALMMAAVIIAAGMFLGVLNETGMLKAIATNLIKVIPAEVGPYLHIIVGLLG
    Newman          ERLRAHAPNALMMAAVIIAAGMFLGVLNETGMLKAIATNLIKVIPAEVGPYLHIIVGLLG
    USA300_FPR3757  ERLRAHAPNALMMAAVIIAAGMFLGVLNETGMLKAIATNLIKVIPAEVGPYLHIIVGLLG
                    ************************************************************

    COL             VPLDLLTSTDAYYFAVLPIVEQTAGQFGVPSVSTAYSMVIGNIIGTFVSPFSPALWLAIG
    N315            VPLDLLTSTDAYYFAVLPIVEQTAGQFGVPSVSTAYSMVIGNIIGTFVSPFSPALWLAIG
    NCTC8325        VPLDLLTSTDAYYFAVLPIVEQTAGQFGVPSVSTAYSMVIGNIIGTFVSPFSPALWLAIG
    Newman          VPLDLLTSTDAYYFAVLPIVEQTAGQFGVPSVSTAYSMVIGNIIGTFVSPFSPALWLAIG
    USA300_FPR3757  VPLDLLTSTDAYYFAVLPIVEQTAGQFGVPSVSTAYSMVIGNIIGTFVSPFSPALWLAIG
                    ************************************************************

    COL             LAEANMGTYIKYAFFWIWGFAIVMLVIAMLMGIVTI
    N315            LAEANMGTYIKYAFFWIWGFAIVMLVIAMLMGIVTI
    NCTC8325        LAEANMGTYIKYAFFWIWGFAIVMLVIAMLMGIVTI
    Newman          LAEANMGTYIKYAFFWIWGFAIVMLVIAMLMGIVTI
    USA300_FPR3757  LAEANMGTYIKYAFFWIWGFAIVMLVIAMLMGIVTI
                    ************************************