From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006359000
  • symbol?: arcR
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • cyclic nucleotide-binding protein
    • transcriptional regulator, Crp/Fnr family
    • Transcriptional regulator ArcR essential for anaerobic expression of the ADI pathway, Crp/Fnr family
    • cyclic nucleotide-binding domain-containing protein
    • regulatory protein
    • HTH-type transcriptional regulator ArcR
    • Crp/FNR family transcriptional regulator
    • transcriptional regulator Crp/Fnr family protein
    • Crp family transcriptional regulator
    • putative regulatory protein
    • crp family transcription regulator
  • strand?: -
  • coordinates?: 6394619..6395305
  • synteny block?: BlockID0050680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2570
    08BA02176:
    C248_2699
    11819-97:
    MS7_2636 (arcR)
    71193:
    ST398NM01_2681
    ECT-R 2:
    ECTR2_2485
    ED133:
    SAOV_2680c
    ED98:
    SAAV_2700
    HO 5096 0412:
    SAEMRSA15_25360
    JH1:
    SaurJH1_2711
    JH9:
    SaurJH9_2655
    JKD6008:
    SAA6008_02690
    JKD6159:
    SAA6159_02527
    LGA251:
    SARLGA251_24030 (arcR)
    M013:
    M013TW_2612
    MRSA252:
    SAR2710
    MSHR1132:
    SAMSHR1132_24550
    MSSA476:
    SAS2517
    Mu3:
    SAHV_2615
    Mu50:
    SAV2631
    MW2:
    MW2552
    RF122:
    SAB2506c
    ST398:
    SAPIG2681
    T0131:
    SAT0131_02897 (dapB)
    TCH60:
    HMPREF0772_10558
    TW20:
    SATW20_27690 (arcR)
    USA300_TCH1516:
    USA300HOU_2631
    VC40:
    SAVC_12035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------MGRNNKLEHELKALADYINIPYSILQPYQSECFVRHYTKGQVIYFSPQESSNIY
    N315            MTENFILGRNNKLEHELKALADYINIPYSILQPYQSECFVRHYTKGQVIYFSPQESSNIY
    NCTC8325        MTENFILGRNNKLEHELKALADYINIPYSILQPYQSECFVRHYTKGQVIYFSPQESSNIY
    Newman          MTENFILGRNNKLEHELKALADYINIPYSILQPYQSECFVRHYTKGQVIYFSPQESSNIY
    USA300_FPR3757  MTENFILGRNNKLEHELKALADYINIPYSILQPYQSECFVRHYTKGQVIYFSPQESSNIY
                          :*****************************************************

    COL             FLIEGNIIREHYNQNGDVYRYFNKEQVLFPISNLFHPKEVNELCTALTDCTVLGLPRELM
    N315            FLIEGNIIREHYNQNGDVYRYFNKEQVLFPISNLFHPKEVNELCTALTDCTVLGLPRELM
    NCTC8325        FLIEGNIIREHYNQNGDVYRYFNKEQVLFPISNLFHPKEVNELCTALTDCTVLGLPRELM
    Newman          FLIEGNIIREHYNQNGDVYRYFNKEQVLFPISNLFHPKEVNELCTALTDCTVLGLPRELM
    USA300_FPR3757  FLIEGNIIREHYNQNGDVYRYFNKEQVLFPISNLFHPKEVNELCTALTDCTVLGLPRELM
                    ************************************************************

    COL             AFLCKANDDIFLTLFALINDNEQQHMNYNMALTSKFAKDRIIKLICHLCQTVGYDQDEFY
    N315            AFLCKANDDIFLTLFALINDNEQQHMNYNMALTSKFAKDRIIKLLCHLCQTVGYDQDEFY
    NCTC8325        AFLCKANDDIFLTLFALINDNEQQHMNYNMALTSKFAKDRIIKLICHLCQTVGYDQDEFY
    Newman          AFLCKANDDIFLTLFALINDNEQQHMNYNMALTSKFAKDRIIKLICHLCQTVGYDQDEFY
    USA300_FPR3757  AFLCKANDDIFLTLFALINDNEQQHMNYNMALTSKFAKDRIIKLICHLCQTVGYDQDEFY
                    ********************************************:***************

    COL             EIKQFLTIQLMSDMAGISRETAGHIIHELKDEKLVVKDHKNWLVSKHLFNDVCV
    N315            EIKQFLTIQLMSDMAGISRETAGHIIHELKDEKLVVKDHKNWLVSKHLFNDVCV
    NCTC8325        EIKQFLTIQLMSDMAGISRETAGHIIHELKDEKLVVKDHKNWLVSKHLFNDVCV
    Newman          EIKQFLTIQLMSDMAGISRETAGHIIHELKDEKLVVKDHKNWLVSKHLFNDVCV
    USA300_FPR3757  EIKQFLTIQLMSDMAGISRETAGHIIHELKDEKLVVKDHKNWLVSKHLFNDVCV
                    ******************************************************