From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006362000
  • symbol?: arcD
  • description?: arginine/ornithine antiporter

      descriptions from strain specific annotations:

    • arginine/ornithine antiporter
    • arginine-ornithine antiporter
    • arginine/oirnithine antiporter
    • APC family amino acid-polyamine-organocation transporter
    • APC family arginine/ornithine antiporter
    • Arginine/ornithine antiporter ArcD
    • arginine/ornithine APC family amino acid-polyamine-organocation transporter, antiporter
  • strand?: -
  • coordinates?: 6396384..6397814
  • synteny block?: BlockID0050710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2655 (arcD)
    N315:
    SA2426 (arcD)
    NCTC8325:
    Newman:
    NWMN_2532 (arcD)
    USA300_FPR3757:
    04-02981:
    SA2981_2572 (arcD)
    08BA02176:
    C248_2701 (arcD)
    11819-97:
    MS7_2638 (arcD)
    71193:
    ST398NM01_2683
    ECT-R 2:
    ECTR2_2487
    ED133:
    SAOV_2682c
    ED98:
    SAAV_2702 (arcD)
    HO 5096 0412:
    SAEMRSA15_25380 (arcD)
    JH1:
    SaurJH1_2713
    JH9:
    SaurJH9_2657
    JKD6008:
    SAA6008_02692 (arcD)
    JKD6159:
    SAA6159_02529 (arcD)
    LGA251:
    SARLGA251_24050 (arcD)
    M013:
    M013TW_2614
    MRSA252:
    SAR2712 (arcD)
    MSHR1132:
    SAMSHR1132_24570
    MSSA476:
    SAS2519
    Mu3:
    SAHV_2617 (arcD)
    Mu50:
    SAV2633 (arcD)
    MW2:
    MW2554 (arcD)
    RF122:
    SAB2508c (arcD)
    ST398:
    SAPIG2683
    T0131:
    SAT0131_02899 (hipO)
    TCH60:
    HMPREF0772_10555 (arcD)
    TW20:
    SATW20_27710 (arcD)
    USA300_TCH1516:
    USA300HOU_2633 (arcD3)
    VC40:
    SAVC_12045

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNESGDNKLSKSSLIGLVIGSMIGGGAFNIMSDMGGKAGGLAIIIGWIITAIGMISLAFV
    N315            MNESGDNKLSKSSLIGLVIGSMIGGGAFNIMSDMGGKAGGLAIIIGWIITAIGMISLAFV
    NCTC8325        MNESGDNKLSKSSLIGLVIGSMIGGGAFNIMSDMGGKAGGLAIIIGWIITAIGMISLAFV
    Newman          MNESGDNKLSKSSLIGLVIGSMIGGGAFNIMSDMGGKAGGLAIIIGWIITAIGMISLAFV
    USA300_FPR3757  MNESGDNKLSKSSLIGLVIGSMIGGGAFNIMSDMGGKAGGLAIIIGWIITAIGMISLAFV
                    ************************************************************

    COL             FQNLTNERPELDGGIYSYAQAGFGDFVGFISAWGYWFSAFLGNVAYATLLMSAVGNFFPI
    N315            FQNLTNERPELDGGIYSYAQAGFGDFVGFISAWGYWFSAFLGNVAYATLLMSAVGNFFPI
    NCTC8325        FQNLTNERPELDGGIYSYAQAGFGDFVGFISAWGYWFSAFLGNVAYATLLMSAVGNFFPI
    Newman          FQNLTNERPELDGGIYSYAQAGFGDFVGFISAWGYWFSAFLGNVAYATLLMSAVGNFFPI
    USA300_FPR3757  FQNLTNERPELDGGIYSYAQAGFGDFVGFISAWGYWFSAFLGNVAYATLLMSAVGNFFPI
                    ************************************************************

    COL             FKGGNTLPSVIVASLLLWGVHFLILKGVETAAFINSIVTVAKLIPILLVIICMIIAFNFD
    N315            FKGGNTLPSIIVASLLLWGVHFLILKGVETAAFINSIVTVAKLIPILLVIICMIIAFNFD
    NCTC8325        FKGGNTLPSVIVASLLLWGVHFLILKGVETAAFINSIVTVAKLIPILLVIICMIIAFNFD
    Newman          FKGGNTLPSVIVASLLLWGVHFLILKGVETAAFINSIVTVAKLIPILLVIICMIIAFNFD
    USA300_FPR3757  FKGGNTLPSVIVASLLLWGVHFLILKGVETAAFINSIVTVAKLIPILLVIICMIIAFNFD
                    *********:**************************************************

    COL             TFKTGFFSMTSEGVLPFSWASTMSQVKSTMLVTVWVFIGIEGAVIFSSRAKNKKDVGSAT
    N315            TFKTGFFGMTSEGVLPFSWASTMSQVKSTMLVTVWVFIGIEGAVIFSSRAKNKKDVGSAT
    NCTC8325        TFKTGFFSMTSEGVLPFSWASTMSQVKSTMLVTVWVFIGIEGAVIFSSRAKNKKDVGSAT
    Newman          TFKTGFFSMTSEGVLPFSWASTMSQVKSTMLVTVWVFIGIEGAVIFSSRAKNKKDVGSAT
    USA300_FPR3757  TFKTGFFSMTSEGVLPFSWASTMSQVKSTMLVTVWVFIGIEGAVIFSSRAKNKKDVGSAT
                    *******.****************************************************

    COL             VIGLISVLIIYFLLTVLAQGVILQNHISQLDSPSMAQVLATIVGGWGSTLVNIGLIISVL
    N315            VIGLISVLIIYFLLTVLAQGVILQNHISQLDSPSMAQVLATIVGGWGSTLVNIGLIISVL
    NCTC8325        VIGLISVLIIYFLLTVLAQGVILQNHISQLDSPSMAQVLATIVGGWGSTLVNIGLIISVL
    Newman          VIGLISVLIIYFLLTVLAQGVILQNHISQLDSPSMAQVLATIVGGWGSTLVNIGLIISVL
    USA300_FPR3757  VIGLISVLIIYFLLTVLAQGVILQNHISQLDSPSMAQVLATIVGGWGSTLVNIGLIISVL
                    ************************************************************

    COL             GAWLGWTLLAGELPFIVAKDGLFPKWFAKENKNGAPVNALLITNILVQLFLISMLFTQSA
    N315            GAWLGWTLLAGELPFIVAKDGLFPKWFAKENKNGAPVNALLITNILVQLFLISMLFTQSA
    NCTC8325        GAWLGWTLLAGELPFIVAKDGLFPKWFAKENKNGAPVNALLITNILVQLFLISMLFTQSA
    Newman          GAWLGWTLLAGELPFIVAKDGLFPKWFAKENKNGAPVNALLITNILVQLFLISMLFTQSA
    USA300_FPR3757  GAWLGWTLLAGELPFIVAKDGLFPKWFAKENKNGAPVNALLITNILVQLFLISMLFTQSA
                    ************************************************************

    COL             YQFAFSLASSAILYPYMFSAFYQVKYTLEHRQQATTKQWTIGIIASIYAIWLIYAAGINY
    N315            YQFAFSLASSAILYPYMFSAFYQVKYTLEHRQQATTKQWTIGIIASIYAIWLIYAAGINY
    NCTC8325        YQFAFSLASSAILYPYMFSAFYQVKYTLEHRQQATTKQWTIGIIASIYAIWLIYAAGINY
    Newman          YQFAFSLASSAILYPYMFSAFYQVKYTLEHRQQATTKQWTIGIIASIYAIWLIYAAGINY
    USA300_FPR3757  YQFAFSLASSAILYPYMFSAFYQVKYTLEHRQQATTKQWTIGIIASIYAIWLIYAAGINY
                    ************************************************************

    COL             LLLTMLLYIPALLVYTIVQKNNQTRLIKSDYILFMIIIVLAVIGLIKLLMGTINVF
    N315            LLLTMLLYIPALLVYSIVQKNNQTRLIKSDYILFMIIIVLAVIGLIKLLMGTINVF
    NCTC8325        LLLTMLLYIPALLVYTIVQKNNQTRLIKSDYILFMIIIVLAVIGLIKLLMGTINVF
    Newman          LLLTMLLYIPALLVYTIVQKNNQTRLIKSDYILFMIIIVLAVIGLIKLLMGTINVF
    USA300_FPR3757  LLLTMLLYIPALLVYTIVQKNNQTRLIKSDYILFMIIIVLAVIGLIKLLMGTINVF
                    ***************:****************************************