From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006389000
  • symbol?: secY2
  • description?: accessory Sec system protein translocase subunit SecY2

      descriptions from strain specific annotations:

    • accessory Sec system protein translocase subunit SecY2
    • preprotein translocase subunit SecY
    • preprotein translocase SecY subunit-like protein
    • Preprotein translocase SecY2 subunit
    • accessory Sec system translocase SecY2
    • eubacterial secY family protein
    • Preprotein translocase subunit SecY2
    • SecY protein
    • translocase, putative
  • strand?: -
  • coordinates?: 6431116..6432162
  • synteny block?: BlockID0050960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2675 (secY)
    N315:
    SA2446 (secY)
    NCTC8325:
    Newman:
    NWMN_2552 (secY)
    USA300_FPR3757:
    04-02981:
    SA2981_2592 (secY2)
    08BA02176:
    C248_2721
    11819-97:
    MS7_2658 (secY2)
    71193:
    ST398NM01_2703
    ECT-R 2:
    ECTR2_2507
    ED133:
    SAOV_2704c
    ED98:
    SAAV_2724 (secY_1)
    HO 5096 0412:
    SAEMRSA15_25580
    JH1:
    SaurJH1_2733 (secY)
    JH9:
    SaurJH9_2677 (secY)
    JKD6008:
    SAA6008_02712 (secY)
    JKD6159:
    SAA6159_02549 (secY)
    LGA251:
    SARLGA251_24250
    M013:
    M013TW_2634
    MRSA252:
    SAR2733 (secY)
    MSHR1132:
    SAMSHR1132_24770
    MSSA476:
    SAS2539 (secY)
    Mu3:
    SAHV_2637 (secY)
    Mu50:
    SAV2653 (secY)
    MW2:
    MW2574 (secY)
    RF122:
    SAB2528c
    ST398:
    SAPIG2703
    T0131:
    SAT0131_02922 (sucB)
    TCH60:
    HMPREF0772_10534 (secY)
    TW20:
    SATW20_27910
    USA300_TCH1516:
    USA300HOU_2653 (secY)
    VC40:
    SAVC_12145 (secY)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKLLQQYEYKIIYKRMLYTCFILFIYILGTNISIVSYNDMQVKHESFFKIAISNMGGDV
    N315            MLKLLQQYEYKIIYKRMLYTCFILFIYILGTNISIVSYNDMQVKHESFFKIAISNMGGDV
    NCTC8325        MLKLLQQYEYKIIYKRMLYTCFILFIYILGTNISIVSYNDMQVKHESFFKIAISNMGGDV
    Newman          MLKLLQQYEYKIIYKRMLYTCFILFIYILGTNISIVSYNDMQVKHESFFKIAISNMGGDV
    USA300_FPR3757  MLKLLQQYEYKIIYKRMLYTCFILFIYILGTNISIVSYNDMQVKHESFFKIAISNMGGDV
                    ************************************************************

    COL             NTLNIFTLGLGPWLTSMIILMLISYRNMDKYMKQTSLEKHYKERILTLILSVIQSYFVIH
    N315            NTLNIFTLGLVPWLTSMIILMLISYRNMDKYMKQTSLEKHYKERILTLILSVIQSYFVIH
    NCTC8325        NTLNIFTLGLGPWLTSMIILMLISYRNMDKYMKQTSLEKHYKERILTLILSVIQSYFVIH
    Newman          NTLNIFTLGLGPWLTSMIILMLISYRNMDKYMKQTSLEKHYKERILTLILSVIQSYFVIH
    USA300_FPR3757  NTLNIFTLGLGPWLTSMIILMLISYRNMDKYMKQTSLEKHYKERILTLILSVIQSYFVIH
                    ********** *************************************************

    COL             EYVSKERVHQDNIYLTILILVTGTMLLVWLADKNSRYGIAGPMPIVMVSIIKSMMHQKME
    N315            EYVSKERVHQDNIYLTILILVTGTMLLVWLADKNSRYGIAGPMPIVMVSIIKSMMHQKME
    NCTC8325        EYVSKERVHQDNIYLTILILVTGTMLLVWLADKNSRYGIAGPMPIVMVSIIKSMMHQKME
    Newman          EYVSKERVHQDNIYLTILILVTGTMLLVWLADKNSRYGIAGPMPIVMVSIIKSMMHQKME
    USA300_FPR3757  EYVSKERVHQDNIYLTILILVTGTMLLVWLADKNSRYGIAGPMPIVMVSIIKSMMHQKME
                    ************************************************************

    COL             YIDASHIVIALLIILVIITLFILLFIELVEVRIPYIDLMNVSATNMKSYLSWKVNPAGSI
    N315            YIDASHIVIALLIILVIITLFILLFIELVEVRIPYIDLMNVSATNMKSYLSWKVNPAGSI
    NCTC8325        YIDASHIVIALLIILVIITLFILLFIELVEVRIPYIDLMNVSATNMKSYLSWKVNPAGSI
    Newman          YIDASHIVIALLIILVIITLFILLFIELVEVRIPYIDLMNVSATNMKSYLSWKVNPAGSI
    USA300_FPR3757  YIDASHIVIALLIILVIITLFILLFIELVEVRIPYIDLMNVSATNMKSYLSWKVNPAGSI
                    ************************************************************

    COL             TLMMSISAFVFLKSGIHFILSMFNKSISDDMPMLTFDSPVGISVYLVIQMLLGYFLSRFL
    N315            TLMMSISAFVFLKSGIHFILSMFNKSISDDMPMLTFDSPVGISVYLVIQMLLGYFLSRFL
    NCTC8325        TLMMSISAFVFLKSGIHFILSMFNKSISDDMPMLTFDSPVGISVYLVIQMLLGYFLSRFL
    Newman          TLMMSISAFVFLKSGIHFILSMFNKSISDDMPMLTFDSPVGISVYLVIQMLLGYFLSRFL
    USA300_FPR3757  TLMMSISAFVFLKSGIHFILSMFNKSISDDMPMLTFDSPVGISVYLVIQMLLGYFLSRFL
                    ************************************************************

    COL             INTKQKSKDFLKSGNYFSGVKPGKDTERYLNYQARRVCWFGLALVTVIIGIPLYFTLFVP
    N315            INTKQKSKDFLKSGNYFSGVKPGKDTERYLNYQARRVCWFGSALVTVIIGIPLYFTLFVP
    NCTC8325        INTKQKSKDFLKSGNYFSGVKPGKDTERYLNYQARRVCWFGLALVTVIIGIPLYFTLFVP
    Newman          INTKQKSKDFLKSGNYFSGVKPGKDTERYLNYQARRVCWFGLALVTVIIGIPLYFTLFVP
    USA300_FPR3757  INTKQKSKDFLKSGNYFSGVKPGKDTERYLNYQARRVCWFGLALVTVIIGIPLYFTLFVP
                    ***************************************** ******************

    COL             HLSTEIYFSVQLIVLVYISINIAETIRTYLYFDKYKPFLNQYW
    N315            HLSTEIYFSVQLIVLVYISINIAETIRTYLYFDKYKPFLNQYW
    NCTC8325        HLSTEIYFSVQLIVLVYISINIAETIRTYLYFDKYKPFLNQYW
    Newman          HLSTEIYFSVQLIVLVYISINIAETIRTYLYFDKYKPFLNQYW
    USA300_FPR3757  HLSTEIYFSVQLIVLVYISINIAETIRTYLYFDKYKPFLNQYW
                    *******************************************