From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006414000
  • symbol?: icaC
  • description?: intercellular adhesion protein C

      descriptions from strain specific annotations:

    • intercellular adhesion protein C
    • poly-beta-1,6-N-acetyl-D-glucosamine export protein
    • intercellular adhesion protein IcaC
    • biofilm PIA synthesis protein icaC (Intercellular adhesion protein C)
    • Polysaccharide intercellular adhesin (PIA) biosynthesis protein IcaC
    • polysaccharide intercellular adhesin (PIA) synthesis/biofilm formation-like protein
    • pseudogene
    • putative poly-beta-1,6-N-acetyl-D-glucosamine export protein
  • strand?: +
  • coordinates?: 6463810..6464874
  • synteny block?: BlockID0051210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2692 (icaC)
    N315:
    SA2462 (icaC)
    NCTC8325:
    Newman:
    NWMN_2568 (icaC)
    USA300_FPR3757:
    04-02981:
    SA2981_2608 (icaC)
    08BA02176:
    C248_2738 (icaC)
    11819-97:
    MS7_2674 (icaC)
    71193:
    ST398NM01_2720
    ECT-R 2:
    ECTR2_2522
    ED133:
    SAOV_2720
    ED98:
    SAAV_2741 (icaC)
    HO 5096 0412:
    SAEMRSA15_25760 (icaC)
    JH1:
    SaurJH1_2750
    JH9:
    SaurJH9_2693
    JKD6008:
    SAA6008_02728 (icaC)
    JKD6159:
    SAA6159_02565 (icaC)
    LGA251:
    SARLGA251_24430 (icaC)
    M013:
    M013TW_2652
    MRSA252:
    SAR2750 (icaC)
    MSHR1132:
    SAMSHR1132_24970
    MSSA476:
    SAS2555
    Mu3:
    SAHV_2653 (icaC)
    Mu50:
    SAV2669 (icaC)
    MW2:
    MW2589 (icaC)
    RF122:
    SAB2544 (icaC)
    ST398:
    SAPIG2720
    T0131:
    SAT0131_02947
    TCH60:
    HMPREF0772_10517 (icaC)
    TW20:
    SATW20_28070 (icaC)
    USA300_TCH1516:
    USA300HOU_2669 (icaC)
    VC40:
    SAVC_12225

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKKIRLELVYLRAIICAIIIITHLLTQITLKHENMEGGSLVLQFYIRNIVIFGTPCFIIL
    NCTC8325        MKKIRLELVYLRAIICAIIIITHLLTQITLKHENMEGGSLVLQFYIRNIVIFGTPCFIIL
    Newman          MKKIRLELVYLRAIICAIIIITHLLTQITLKHENMEGGSLVLQFYIRNIVIFGTPCFIIL
    USA300_FPR3757  MKKIRLELVYLRAIICAIIIITHLLTQITLKHENMEGGSLVLQFYIRNIVIFGTPCFIIL
                    ************************************************************

    N315            SQLLTTLNYQKVTYRYLTTRVKYILIPYILMGLFYSYSESLLTDSSFNKQFIENVLLGQW
    NCTC8325        SQLLTTLNYQKVTYRYLTTRVKYILIPYILMGLFYSYSESLLTDSSFNKQFIENVLLGQW
    Newman          SQLLTTLNYQKVTYRYLTTRVKYILIPYILMGLFYSYSESLLTDSSFNKQFIENVLLGQW
    USA300_FPR3757  SQLLTTLNYQKVTYRYLTTRVKYILIPYILMGLFYSYSESLLTDSSFNKQFIENVLLGQW
                    ************************************************************

    N315            YGYFIVVIMQFFILSYIIFKINYNLFNSKILLLLSFILQQSFLYYFTNNTAFHDTVLHYY
    NCTC8325        YGYFIVVIMQFFILSYIIFKINYNLFNSKILLLLSFILQQSFLYYFTNNTAFHDTVLHYY
    Newman          YGYFIVVIMQFFILSYIIFKINYNLFNSKILLLLSFILQQSFLYYFTNNTAFHDTVLHYY
    USA300_FPR3757  YGYFIVVIMQFFILSYIIFKINYNLFNSKILLLLSFILQQSFLYYFTNNTAFHDTVLHYY
                    ************************************************************

    N315            PLSENTIIFGWIFYFFLGAYMGYNYERVLNFLERYLVIMIVLAVATYFVFIALANGDYWN
    NCTC8325        PLSENTIIFGWIFYFFLGAYMGYNYERVLNFLERYLVIMIVLAVATYFVFIALANGDYWN
    Newman          PLSENTIIFGWIFYFFLGAYMGYNYERVLNFLERYLVIMIVLAVATYFVFIALANGDYWN
    USA300_FPR3757  PLSENTIIFGWIFYFFLGAYMGYNYERVLNFLERYLVIMIVLAVATYFVFIALANGDYWN
                    ************************************************************

    N315            VTSFSYSLTPYNSIMFIVILGICTHFKTMLFNTIQMISAFSFFIYLLHPIILDSLFAYTN
    NCTC8325        VTSFSYSLTPYNSIMFIVILGICTHFKTMLFNTIQMISAFSFFIYLLHPIILDSLFAYTN
    Newman          VTSFSYSLTPYNSIMFIVILGICTHFKTMLFNTIQMISAFSFFIYLLHPIILDSLFAYTN
    USA300_FPR3757  VTSFSYSLTPYNSIMFIVILGICTHFKTMLFNTIQMISAFSFFIYLLHPIILDSLFAYTN
                    ************************************************************

    N315            IFEDNTMVFLAISLLFILGLCIGVGMILREFYIFRFIIGKQPYKLNINAY
    NCTC8325        IFEDNTMVFLAISLLFILGLCIGVGMILREFYIFRFIIGKQPYKLNINAY
    Newman          IFEDNTMVFLAISLLFILGLCIGVGMILREFYIFRFIIGKQPYKLNINAY
    USA300_FPR3757  IFEDNTMVFLAISLLFILGLCIGVGMILREFYIFRFIIGKQPYKLNINAY
                    **************************************************