From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006445000
  • symbol?: drp35
  • description?: lactonase

      descriptions from strain specific annotations:

    • lactonase
    • drP35 protein
    • lactonase Drp35
    • Drp35
    • SMP-30/gluconolaconase/LRE domain-containing protein
    • antibiotic-induced protein
    • antibiotic-induced protein, Drp35
    • arylesterase family protein
    • gluconolactonase
  • strand?: -
  • coordinates?: 6489297..6490268
  • synteny block?: BlockID0051520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2712 (drp35)
    N315:
    SA2480 (drp35)
    NCTC8325:
    Newman:
    NWMN_2586 (drp35)
    USA300_FPR3757:
    04-02981:
    SA2981_2628 (drp35)
    08BA02176:
    C248_2752
    11819-97:
    MS7_2694 (drp35)
    71193:
    ST398NM01_2734
    ECT-R 2:
    ECTR2_2541
    ED133:
    SAOV_2734c
    ED98:
    SAAV_2762 (drp35)
    HO 5096 0412:
    SAEMRSA15_25890 (drp35)
    JH1:
    SaurJH1_2769
    JH9:
    SaurJH9_2712
    JKD6008:
    SAA6008_02747 (drp35)
    JKD6159:
    SAA6159_02585 (drp35)
    LGA251:
    SARLGA251_24560 (drp35)
    M013:
    M013TW_2671
    MRSA252:
    SAR2770 (drp35)
    MSHR1132:
    SAMSHR1132_25170
    MSSA476:
    SAS2574
    Mu3:
    SAHV_2672 (drp35)
    Mu50:
    SAV2688 (drp35)
    MW2:
    MW2608 (drp35)
    RF122:
    SAB2564c (drp35)
    ST398:
    SAPIG2734
    T0131:
    SAT0131_02967 (ilvA)
    TCH60:
    HMPREF0772_10498 (drp)
    TW20:
    SATW20_28250 (drp35)
    USA300_TCH1516:
    USA300HOU_2690
    VC40:
    SAVC_12315

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MSQQDLPTLFYSGKSNSAVPIISESELQTITAEPWLEISKKGLQLEGLNFDRQGQLFLL
    N315            MMSQQDLPTLFYSGKSNSAVPIISESELQTITAEPWLEISKKGLQLEGLNFDRQGQLFLL
    NCTC8325        -MSQQDLPTLFYSGKSNSAVPIISESELQTITAEPWLEISKKGLQLEGLNFDRQGQLFLL
    Newman          -MSQQDLPTLFYSGKSNSAVPIISESELQTITAEPWLEISKKGLQLEGLNFDRQGQLFLL
    USA300_FPR3757  -MSQQDLPTLFYSGKSNSAVPIISESELQTITAEPWLEISKKGLQLEGLNFDRQGQLFLL
                     ***********************************************************

    COL             DVFEGNIFKINPETKEIKRPFVSHKANPAAIKIHKDGRLFVCYLGDFKSTGGIFAATENG
    N315            DVFEGNIFKINPETKEIKRPFVSHKANPAAIKIHKDGRLFVCYLGDFKSTGGIFAATENG
    NCTC8325        DVFEGNIFKINPETKEIKRPFVSHKANPAAIKIHKDGRLFVCYLGDFKSTGGIFAATENG
    Newman          DVFEGNIFKINPETKEIKRPFVSHKANPAAIKIHKDGRLFVCYLGDFKSTGGIFAATENG
    USA300_FPR3757  DVFEGNIFKINPETKEIKRPFVSHKANPAAIKIHKDGRLFVCYLGDFKSTGGIFAATENG
                    ************************************************************

    COL             DNLQDIIEDLSTAYCIDDMVFDSKGGFYFTDFRGYSTNPLGGVYYVSPDFRTVTPIIQNI
    N315            DNLQDIIEDLSTAYCIDDMVFDSKGGFYFTDFRGYSTNPLGGVYYVSPDFRTVTPIIQNI
    NCTC8325        DNLQDIIEDLSTAYCIDDMVFDSKGGFYFTDFRGYSTNPLGGVYYVSPDFRTVTPIIQNI
    Newman          DNLQDIIEDLSTAYCIDDMVFDSKGGFYFTDFRGYSTNPLGGVYYVSPDFRTVTPIIQNI
    USA300_FPR3757  DNLQDIIEDLSTAYCIDDMVFDSKGGFYFTDFRGYSTNPLGGVYYVSPDFRTVTPIIQNI
                    ************************************************************

    COL             SVANGIALSTDEKVLWVTETTANRLHRIALEDDGVTIQPFGATIPYYFTGHEGPDSCCID
    N315            SVANGIALSTDEKVLWVTETTANRLHRIALEDDGVTIQPFGATIPYYFTGHEGPDSCCID
    NCTC8325        SVANGIALSTDEKVLWVTETTANRLHRIALEDDGVTIQPFGATIPYYFTGHEGPDSCCID
    Newman          SVANGIALSTDEKVLWVTETTANRLHRIALEDDGVTIQPFGATIPYYFTGHEGPDSCCID
    USA300_FPR3757  SVANGIALSTDEKVLWVTETTANRLHRIALEDDGVTIQPFGATIPYYFTGHEGPDSCCID
                    ************************************************************

    COL             SDDNLYVAMYGQGRVLVFNKRGYPIGQILIPGRDEGHMLRSTHPQFIPGTNQLIICSNDI
    N315            SDDNLYVAMYGQGRVLVFNKRGYPIGQILIPGRDEGHMLRSTHPQFIPGTNQLIICSNDI
    NCTC8325        SDDNLYVAMYGQGRVLVFNKRGYPIGQILIPGRDEGHMLRSTHPQFIPGTNQLIICSNDI
    Newman          SDDNLYVAMYGQGRVLVFNKRGYPIGQILIPGRDEGHMLRSTHPQFIPGTNQLIICSNDI
    USA300_FPR3757  SDDNLYVAMYGQGRVLVFNKRGYPIGQILIPGRDEGHMLRSTHPQFIPGTNQLIICSNDI
                    ************************************************************

    COL             EMGGGSMLYTVNGFAKGHQSFQFQ
    N315            EMGGGSMLYTVNGFAKGHQSFQFQ
    NCTC8325        EMGGGSMLYTVNGFAKGHQSFQFQ
    Newman          EMGGGSMLYTVNGFAKGHQSFQFQ
    USA300_FPR3757  EMGGGSMLYTVNGFAKGHQSFQFQ
                    ************************