Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1430 [new locus tag: SAUSA300_RS07805 ]
  • pan locus tag?: SAUPAN001309000
  • symbol: SAUSA300_1430
  • pan gene symbol?:
  • synonym:
  • product: phiSLT ORF 87-like protein DNA-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1430 [new locus tag: SAUSA300_RS07805 ]
  • symbol: SAUSA300_1430
  • product: phiSLT ORF 87-like protein DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1586683..1586946
  • length: 264
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGCCAAAAATCATAGTACCACCAACACCAGAAAACACATATAGAGGCGAAGAAAAATTT
    GTGAAAAAGTTATACGCAACACCTACACAAATCCATCAATTGTTTGGAGTATGTAGAAGT
    ACAGTATACAACTGGTTGAAATATTACCGCAAAGATAATTTAGGTGTAGAAAATTTATAC
    ATTGATTATTCACCAACAGGCACTCTGATTAATATTTCTAAATTGGAAGAGTATTTGATC
    AGAAAGCATAAAAAATGGTATTAG
    60
    120
    180
    240
    264

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1430 [new locus tag: SAUSA300_RS07805 ]
  • symbol: SAUSA300_1430
  • description: phiSLT ORF 87-like protein DNA-binding protein
  • length: 87
  • theoretical pI: 9.82716
  • theoretical MW: 10444.1
  • GRAVY: -0.611494

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Phage protein 
  • PFAM:
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 29.6)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 21.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 21.3)
    HTH_OrfB_IS605; Helix-turn-helix domain (PF12323; HMM-score: 18)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 17.5)
    HTH_Tnp_IS630; Transposase (PF01710; HMM-score: 17.1)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 16.5)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.8)
    HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.8)
    Phage_AlpA; Prophage CP4-57 regulatory protein (AlpA) (PF05930; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.137
    • Ymax_pos: 17
    • Cmax: 0.108
    • Cmax_pos: 40
    • Smax: 0.225
    • Smax_pos: 11
    • Smean: 0.16
    • D: 0.146
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MPKIIVPPTPENTYRGEEKFVKKLYATPTQIHQLFGVCRSTVYNWLKYYRKDNLGVENLYIDYSPTGTLINISKLEEYLIRKHKKWY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]