Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2633 [new locus tag: SAUSA300_RS14625 ]
- pan locus tag?: SAUPAN006465000
- symbol: SAUSA300_2633
- pan gene symbol?: vraD
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2633 [new locus tag: SAUSA300_RS14625 ]
- symbol: SAUSA300_2633
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 2859424..2860182
- length: 759
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913207 NCBI
- RefSeq: YP_495267 NCBI
- BioCyc: GH3C-2619 BioCyc
- MicrobesOnline: 1294148 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGACGATATTATCAGTGCAACATGTTTCAAAAACATACGGTAAAAAGCACACATTTCAA
GCACTTAAAGATATTAACTTTGACATACAAAAAGGCGAATTCGTTGCGATTATGGGGCCT
TCTGGATCAGGTAAGACAACCTTATTAAATGTACTAAGTTCAATTGACCAAATTTCTAGC
GGTAGCGTGATTGCTAACGGACAAGAGCTTAATAAACTTAATCAAAAAGCACTTGCCAAA
TTCCGCAAAGAATCATTAGGTTTCATCTTCCAAGATTACAGTATTCTGCCGACATTAACC
GTTAAAGAAAACATTATGTTACCTTTATCTGTTCAAAAAATGTCGAAGGCAACAATGGAA
GAAAATTATAAAGCGATCACGACAGCATTAGGTATTTATGACCTAGGAAATAAATACCCT
AGCGAATTATCTGGTGGTCAACAACAAAGAACTGCAGCAGCGAGAGCATTTGTTCACAAA
CCACAAATCATATTTGCAGATGAGCCAACAGGCGCACTCGACTCGAAAAGTGCAAATGAC
CTATTACAACGTTTGGAAGAAATGAATAAATCGTTTGATACAACTATTGTCATGGTTACA
CATGATCCGGTTGCAGCAAGTTTTGCAGAACGTGTCATCATGCTAAAAGATGGCCAAATT
CATACACAACTTTATCAGGAAGGACGTTCTAAACAGGCCTTTTATGAAGACATTGTACAT
CTTCAATCAGTATTAGGTGGTGTCTCAAATGACATTTAA60
120
180
240
300
360
420
480
540
600
660
720
759
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2633 [new locus tag: SAUSA300_RS14625 ]
- symbol: SAUSA300_2633
- description: ABC transporter ATP-binding protein
- length: 252
- theoretical pI: 7.89757
- theoretical MW: 27774.6
- GRAVY: -0.209127
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 220.9)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 220.9)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 218.7)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 205.5)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 199.1)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 198.8)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 185.8)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 181.5)and 79 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 157.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 154.8)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 154.4)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 151.8)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 151.4)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 147.6)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 146.3)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 140.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 139.4)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 138.8)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 138.8)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 137.8)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 137)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 136.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 134.8)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 134.8)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 134.3)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 133.4)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 132)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 132)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 131.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 130.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 130.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 121.8)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 119.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 118.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 113.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.1)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.1)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 111.8)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 109.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 107)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 107)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 103.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 102.6)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 102.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 101.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 99.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 96.8)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 94.8)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 94.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 94.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 94.6)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 91.2)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 91.2)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 91.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 89.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 86.2)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 83)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 79.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 77.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 75.7)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 68.5)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 68.5)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 67.7)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 66.8)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 58.2)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 56)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 56)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 55.2)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 43.4)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 36.3)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 33.3)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 17.7)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.5)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 16)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 15.4)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 15.2)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 15)Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 14.4)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 13.6)DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 12.9)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.6)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 12.5)nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 12.4)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 11.9)Energy metabolism ATP-proton motive force interconversion ATP synthase archaeal, A subunit (TIGR01043; EC 3.6.3.14; HMM-score: 11.4)rad50 (TIGR00606; HMM-score: 10.5)
- TheSEED :
- transporter, ATP-binding protein SERP0021
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 111.6)and 32 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 27)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 26.5)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 25.1)AAA_16; AAA ATPase domain (PF13191; HMM-score: 23.5)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 23)AAA_23; AAA domain (PF13476; HMM-score: 22.7)AAA_25; AAA domain (PF13481; HMM-score: 19.9)AAA_22; AAA domain (PF13401; HMM-score: 19.8)AAA_30; AAA domain (PF13604; HMM-score: 19.7)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 18.5)IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 18.4)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 17.9)AAA_18; AAA domain (PF13238; HMM-score: 17.2)AAA_28; AAA domain (PF13521; HMM-score: 16.6)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 16.5)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 16.3)NTPase_1; NTPase (PF03266; HMM-score: 16.2)Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 14.6)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 14.5)AAA_15; AAA ATPase domain (PF13175; HMM-score: 14.5)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 14.4)AAA_19; AAA domain (PF13245; HMM-score: 13.8)dNK; Deoxynucleoside kinase (PF01712; HMM-score: 13.7)NACHT; NACHT domain (PF05729; HMM-score: 13.4)PhoH; PhoH-like protein (PF02562; HMM-score: 13)AAA_24; AAA domain (PF13479; HMM-score: 12.8)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.7)AAA_17; AAA domain (PF13207; HMM-score: 12.7)Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 12.6)FtsK_SpoIIIE; FtsK/SpoIIIE family (PF01580; HMM-score: 12.4)Septin; Septin (PF00735; HMM-score: 11.8)NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004962
- TAT(Tat/SPI): 0.000522
- LIPO(Sec/SPII): 0.000452
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTILSVQHVSKTYGKKHTFQALKDINFDIQKGEFVAIMGPSGSGKTTLLNVLSSIDQISSGSVIANGQELNKLNQKALAKFRKESLGFIFQDYSILPTLTVKENIMLPLSVQKMSKATMEENYKAITTALGIYDLGNKYPSELSGGQQQRTAAARAFVHKPQIIFADEPTGALDSKSANDLLQRLEEMNKSFDTTIVMVTHDPVAASFAERVIMLKDGQIHTQLYQEGRSKQAFYEDIVHLQSVLGGVSNDI
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.