Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS01855 [old locus tag: SAUSA300_0350 ]
- pan locus tag?: SAUPAN001892000
- symbol: SAUSA300_RS01855
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS01855 [old locus tag: SAUSA300_0350 ]
- symbol: SAUSA300_RS01855
- product: transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 401561..401764
- length: 204
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (401561..401764) NCBI
- BioCyc: see SAUSA300_0350
- MicrobesOnline: see SAUSA300_0350
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGCGTAATCGATTGAAAGAATTACGAGCACGAGATGGCTTAAACCAAACGCAACTTGCT
AAACAAGCGGGCGTTTCAAGACAAACCATATCGCTAATTGAGCGAAACAATTTTATGCCA
TCAGTATTAACGGCAATAAAAATTGCTCGCATTTTCAATGAAACGGTGGAAACTGTTTTT
ATTATTGAGGAGGATGAGGCATGA60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS01855 [old locus tag: SAUSA300_0350 ]
- symbol: SAUSA300_RS01855
- description: transcriptional regulator
- length: 67
- theoretical pI: 9.43033
- theoretical MW: 7688.8
- GRAVY: -0.304478
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)and 7 moreMobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.3)putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 17.5)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.6)
- TheSEED: see SAUSA300_0350
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 56.5)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46)and 19 moreHTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.4)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 26.4)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 22.6)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 22.6)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 19.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.9)MarR_2; MarR family (PF12802; HMM-score: 18.4)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.4)LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 18.3)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 18.2)MarR; MarR family (PF01047; HMM-score: 17)HTH_11; HTH domain (PF08279; HMM-score: 17)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 15.9)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 14.1)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.9)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.9)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.6)no clan defined TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 13.4)HTH (CL0123) YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002333
- TAT(Tat/SPI): 0.001565
- LIPO(Sec/SPII): 0.000634
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447168757 NCBI
- RefSeq: WP_001246013 NCBI
- UniProt: see SAUSA300_0350
⊟Protein sequence[edit | edit source]
- MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.