Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS10840 [old locus tag: SAUSA300_1973 ]
  • pan locus tag?: SAUPAN005012000
  • symbol: SAUSA300_RS10840
  • pan gene symbol?: hlb-2
  • synonym:
  • product: sphingomyelin phosphodiesterase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS10840 [old locus tag: SAUSA300_1973 ]
  • symbol: SAUSA300_RS10840
  • product: sphingomyelin phosphodiesterase
  • replicon: chromosome
  • strand: +
  • coordinates: 2127706..2128530
  • length: 825
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (2127706..2128530) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGTATCCAAACTGGGGGCAATATAAACGCGCTGATTTAATCGGACAATCTTCTTATATT
    AAAAATAATGATGTCGTAATATTCAATGAAGCATTTGATAATGGTGCATCAGACAAATTA
    TTAAGTAATGTGAAAAAAGAATATCCTTATCAAACACCTGTACTCGGCCGTTCTCAATCA
    GGGTGGGACAAAACTGAAGGTAGCTACTCATCAACTGTTGCAGAAGATGGTGGCGTAGCG
    ATTGTAAGTAAATATCCTATTAAAGAAAAAATCCAGCATGTTTTCAAAAGCGGTTGTGGA
    TTCGATAATGATAGCAACAAAGGCTTTGTTTATACAAAAATAGAGAAAAATGGTAAGAAC
    GTTCACGTTATCGGTACACATACACAATCTGAAGATTCACGTTGTGGTGCTGGACATGAT
    CGAAAAATTAGAGCTGAACAAATGAAAGAAATCAGTGACTTTGTTAAAAAGAAAAATATC
    CCTAAAGATGAAACGGTATATATAGGTGGCGACCTTAATGTCAATAAAGGCACTCCAGAG
    TTCAAAGATATGCTTAAAAACTTGAATGTAAATGATGTTCTATATGCAGGTCATAATAGC
    ACATGGGACCCTCAATCAAATTCAATTGCGAAATATAATTACCCTAATGGTAAACCAGAA
    CATTTAGACTATATATTTACAGATAAAGATCATAAACAACCAAAACAATTAGTCAATGAA
    GTTGTGACTGAAAAACCTAAGCCATGGGATGTATATGCGTTCCCATATTACTACGTTTAC
    AATGATTTTTCAGATCATTACCCAATCAAAGCCTATAGTAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    825

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS10840 [old locus tag: SAUSA300_1973 ]
  • symbol: SAUSA300_RS10840
  • description: sphingomyelin phosphodiesterase
  • length: 274
  • theoretical pI: 8.15182
  • theoretical MW: 31255.6
  • GRAVY: -0.884672

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesPathogenesissphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 383.3)
  • TheSEED:
  • PFAM:
    DNase_I-like (CL0530) Exo_endo_phos; Endonuclease/Exonuclease/phosphatase family (PF03372; HMM-score: 54)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.02
    • Extracellular Score: 9.98
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 37
    • Cmax: 0.117
    • Cmax_pos: 37
    • Smax: 0.193
    • Smax_pos: 27
    • Smean: 0.108
    • D: 0.12
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446205585 NCBI
  • RefSeq: WP_000283440 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS10840 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]