From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01230 [old locus tag: SA0209 ]
  • pan locus tag?: SAUPAN001067000
  • symbol: SA_RS01230
  • pan gene symbol?:
  • synonym:
  • product: maltose ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS01230 [old locus tag: SA0209 ]
  • symbol: SA_RS01230
  • product: maltose ABC transporter permease
  • replicon: chromosome
  • strand: +
  • coordinates: 248103..248942
  • length: 840
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (248103..248942) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACAAAGAAGAAAAACATATTAAAAGCAATCGGTATTTACAGTTTTATAGCGATGATG
    TTTGTCATCATTTTATATCCACTACTGTGGACATTTGGCATTTCCCTTAATCCAGGTACG
    AACTTGTATGGTGCCAAAATGATACCAGACAATGCAACATTTAAAAATTATGCATTCTTA
    CTATTCGATGACAGTAGTCAATACCTGACTTGGTATAAAAATACGCTTATCGTAGCATCT
    GCAAATGCACTGTTTAGTGTGATATTTGTCACGTTAACAGCATATGCTTTTTCTAGATAT
    CGCTTTGTTGGTCGTAAATACGGGCTGATTACATTTTTGATTTTACAAATGTTCCCTGTA
    TTAATGGCAATGGTCGCAATCTATATTTTGCTAAATACAATTGGTTTATTAGATTCTTTA
    TTTGGACTAACACTGGTATATATTGGTGGATCAATACCGATGAATGCCTTTTTAGTGAAA
    GGTTACTTCGATACGATTCCAAAAGAACTTGATGAATCTGCCAAAATTGATGGTGCAGGG
    CATATGCGTATTTTCTTACAAATTATGCTTCCATTAGCTAAGCCGATTTTAGCAGTTGTT
    GCTTTGTTCAATTTTATGGGACCATTTATGGACTTTATATTACCTAAAATACTATTAAGA
    AGTCCTGAAAAATTCACATTAGCAGTTGGATTGTTCAACTTTATTAATGATAAGTATGCA
    AATAATTTCACAGTGTTTGCAGCAGGGGCAATTATGATTGCAGTACCTATAGCAATCGTA
    TTCTTGTTCTTGCAACGCTATTTAGTATCAGGTTTAACAACAGGTGCGACAAAAGGTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS01230 [old locus tag: SA0209 ]
  • symbol: SA_RS01230
  • description: maltose ABC transporter permease
  • length: 279
  • theoretical pI: 10.05
  • theoretical MW: 31154.3
  • GRAVY: 0.813978

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    NifC-like ABC-type porter (TIGR01581; HMM-score: 29.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, permease protein (TIGR03262; HMM-score: 28.1)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, permease protein CysT (TIGR02139; HMM-score: 24.6)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, permease protein (TIGR00969; HMM-score: 23.2)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, permease protein (TIGR02141; HMM-score: 21.6)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsK+-dependent Na+/Ca+ exchanger (TIGR00927; HMM-score: 8.3)
    MetabolismEnergy metabolismElectron transportcytochrome c oxidase, cbb3-type, CcoQ subunit (TIGR02736; EC 1.9.3.1; HMM-score: 6.6)
  • TheSEED:
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 66.3)
    Peptidase_MA (CL0126) DUF3267; Putative zincin peptidase (PF11667; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.184
    • Ymax_pos: 12
    • Cmax: 0.146
    • Cmax_pos: 45
    • Smax: 0.389
    • Smax_pos: 7
    • Smean: 0.345
    • D: 0.247
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

  • GI: 446084806 NCBI
  • RefSeq: WP_000162661 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGISLNPGTNLYGAKMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTAYAFSRYRFVGRKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPMNAFLVKGYFDTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFILPKILLRSPEKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTTGATKG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS01230 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]