From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01915 [old locus tag: SA0334 ]
  • pan locus tag?: SAUPAN001888000
  • symbol: SA_RS01915
  • pan gene symbol?: tatC
  • synonym:
  • product: twin-arginine translocase subunit TatC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS01915 [old locus tag: SA0334 ]
  • symbol: SA_RS01915
  • product: twin-arginine translocase subunit TatC
  • replicon: chromosome
  • strand: -
  • coordinates: 392978..393640
  • length: 663
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (392978..393640) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATACTATTGTCGTTCGTCGTCACAGTCATCGTCGTATATGTTTCATCATTTTGGTGGATG
    ACACCATTCATAACGTATATTACCCGTGCACATGTGTCCTTACATGCATTTTCATTCACA
    GAAATGATCCAAATATACGTGATGATTATATTTTTCATCGCGTTTTGTTTCATTTCACCA
    GTCATGTTTTATCAATTGTGGGCATTCATTGCACCTGGATTACATAATAATGAACGTCAA
    TTTATTTATAAATATAGTTTTTTCAGCGTGTTATTATTCTGTGCTGGCGTCGCTTTTGCA
    TTTTATGTTGGCTTTCCAATAATCATTCAATTCGCGTTAAAATTATCATTAACTTTAAAC
    ATTTCGCCTGTCATTGGCTTTAAAGCGTATTTAGTTGAACTTATCCGTTGGCTTTTCACT
    TTTGGCATTTTATTCCAATTGCCAATATTATTCATAGGACTTGCAAAATTCGGTCTTATA
    GATATCACATCATTGAAGCATTATCGAAAATATATTTATTTCGCTTGCTTTGTGCTGGCA
    AGTATCATTGCACCACCCGATTTAACATTAAATATATTACTTACATTGCCACTCATATTG
    CTCTTTGAGTTCAGTATGTTCATTGTTAAGTTCACATGCCGAGGCAAACCGCCAACACAT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    663

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS01915 [old locus tag: SA0334 ]
  • symbol: SA_RS01915
  • description: twin-arginine translocase subunit TatC
  • length: 220
  • theoretical pI: 9.48042
  • theoretical MW: 25556.8
  • GRAVY: 1.16864

Function[edit source | edit]

  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtwin arginine-targeting protein translocase TatC (TIGR00945; HMM-score: 147.3)
    and 1 more
    Sec-independent protein translocase TatC (TIGR01912; HMM-score: 117.4)
  • TheSEED:
  • PFAM:
    no clan definedTatC; Sec-independent protein translocase protein (TatC) (PF00902; HMM-score: 137.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 7
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.162
    • Ymax_pos: 11
    • Cmax: 0.144
    • Cmax_pos: 64
    • Smax: 0.334
    • Smax_pos: 4
    • Smean: 0.261
    • D: 0.201
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_010922821 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLLSFVVTVIVVYVSSFWWMTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISPVMFYQLWAFIAPGLHNNERQFIYKYSFFSVLLFCAGVAFAFYVGFPIIIQFALKLSLTLNISPVIGFKAYLVELIRWLFTFGILFQLPILFIGLAKFGLIDITSLKHYRKYIYFACFVLASIIAPPDLTLNILLTLPLILLFEFSMFIVKFTCRGKPPTH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS01915 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]