From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02185 [old locus tag: SA0382 ]
  • pan locus tag?: SAUPAN002104000
  • symbol: SA_RS02185
  • pan gene symbol?: ssl1
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS02185 [old locus tag: SA0382 ]
  • symbol: SA_RS02185
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 441102..441782
  • length: 681
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (441102..441782) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATTTAAAGCGATAGCAAAAGCAAGTTTAGCATTGGGAATGTTAGCAACAGGTGTA
    ATTACATCGAATGTACAATCAGTACAAGCGAAAACAGAAGTTAAACAACAAAGTGAATCA
    GAGTTGAAACACTATTATAATAAACCGGTTTTAGAGCGTAAAAATGTTACTGGATATAAA
    TATACTGAAAAAGGTAAAGATTATATAGATGTTATAGTAGACAATCAATATTCTCAAATT
    TCTTTAGTTGGATCTGATAAAGACAAATTTAAAGATGGAGACAACTCGAATATAGATGTG
    TTTATCCTTAGAGAAGGTGACAGTAGACAAGCAACAAATTACTCAATTGGTGGCGTAACA
    AAAACAAACAGTCAACCTTTTATTGACTATATACACACACCAATCCTTGAAATCAAGAAA
    GGTAAAGAAGAACCACAAAGTAGTTTATACCAAATTTATAAAGAAGACATCTCATTGAAA
    GAACTTGATTATAGATTAAGAGAACGTGCAATCAAACAACACGGCTTGTATTCAAATGGT
    CTTAAACAAGGTCAAATTACAATTACAATGAAAGATGGCAAATCACATACTATCGATTTA
    AGTCAAAAACTTGAAAAAGAACGTATGGGTGATTCTATCGACGGCAGACAAATACAAAAA
    ATTCTAGTAGAAATGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    681

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS02185 [old locus tag: SA0382 ]
  • symbol: SA_RS02185
  • description: hypothetical protein
  • length: 226
  • theoretical pI: 9.54588
  • theoretical MW: 25690
  • GRAVY: -0.714159

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    OB_enterotoxin (CL0658) SSL_OB; Staphylococcal superantigen-like OB-fold domain (PF09199; HMM-score: 103.3)
    Ant-toxin_C (CL0386) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 23.8)
    MAP; MAP domain (PF03642; HMM-score: 17.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 31 aa
    • Ymax: 0.793
    • Ymax_pos: 31
    • Cmax: 0.762
    • Cmax_pos: 31
    • Smax: 0.913
    • Smax_pos: 13
    • Smean: 0.857
    • D: 0.818
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446591668 NCBI
  • RefSeq: WP_000669014 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS02185 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]