Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02865 [old locus tag: SA0487 ]
  • pan locus tag?: SAUPAN002297000
  • symbol: SA_RS02865
  • pan gene symbol?: cysE
  • synonym:
  • product: serine acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS02865 [old locus tag: SA0487 ]
  • symbol: SA_RS02865
  • product: serine acetyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 570523..571170
  • length: 648
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (570523..571170) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATCTTGTTAAAAAGAATGAGAGACGATATAAAAATGGTATTTGAGCAGGATCCAGCG
    GCACGTTCAACATTAGAAGTCATTACAACGTATGCAGGTTTACATGCAGTTTGGAGTCAT
    TTGATTGCACATAAGTTATACAACCAAAAAAAATATGTTGCAGCACGCGCGATATCTCAA
    ATTTCAAGATTTTTCACAGGTATAGAAATCCATCCAGGTGCTAAAATTGGAAAGCGTCTA
    TTTATAGATCATGGTATGGGCGTTGTAATAGGAGAAACATGTACAATTGGTGATAATGTG
    ACAATCTATCAAGGCGTGACACTTGGTGGGACAGGGAAAGAAAGAGGGAAAAGACACCCA
    GATATAGGAGACAATGTTTTAATAGCAGCCGGTGCGAAAGTTTTAGGAAATATTAAAATA
    AATTCAAATGTAAATATTGGTGCAAATTCAGTTGTTTTACAATCAGTTCCAAGTTATTCA
    ACGGTTGTTGGTATACCAGGACATATTGTTAAGCAAGATGGTGTTCGAGTTGGAAAAACA
    TTTGATCATCGCCATCTACCTGATCCAATTTATGAACAAATTAAGCATTTAGAACGACAA
    CTTGAAAAGACTAGGAATGGAGAGATTCAAGATGATTACATTATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    648

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS02865 [old locus tag: SA0487 ]
  • symbol: SA_RS02865
  • description: serine acetyltransferase
  • length: 215
  • theoretical pI: 9.85567
  • theoretical MW: 23754.2
  • GRAVY: -0.156279

Function[edit source | edit]

  • reaction:
    EC 2.3.1.30?  ExPASy
    Serine O-acetyltransferaseAcetyl-CoA + L-serine = CoA + O-acetyl-L-serine
  • TIGRFAM:
    MetabolismAmino acid biosynthesisSerine familyserine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 250.8)
    colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 73.2)
    sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 56.8)
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 52.2)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 39.8)
    phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 31.7)
    non-ribosomal peptide synthetase terminal domain of unknown function (TIGR02353; HMM-score: 20.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesacyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 20.1)
    colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 17.7)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.5)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.5)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.5)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 9.2)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 9.2)
  • TheSEED:
  • PFAM:
    HEXAPEP (CL0536) Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 57)
    Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 19.4)
    no clan definedSATase_N; Serine acetyltransferase, N-terminal (PF06426; HMM-score: 18.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.125
    • Ymax_pos: 14
    • Cmax: 0.122
    • Cmax_pos: 44
    • Smax: 0.18
    • Smax_pos: 12
    • Smean: 0.159
    • D: 0.138
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001805237 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MILLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKTFDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS02865 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]