From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS05215 [old locus tag: SA0920 ]
  • pan locus tag?: SAUPAN003281000
  • symbol: SA_RS05215
  • pan gene symbol?: purQ
  • synonym:
  • product: phosphoribosylformylglycinamidine synthase subunit PurQ

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS05215 [old locus tag: SA0920 ]
  • symbol: SA_RS05215
  • product: phosphoribosylformylglycinamidine synthase subunit PurQ
  • replicon: chromosome
  • strand: +
  • coordinates: 1044170..1044841
  • length: 672
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1044170..1044841) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATTTGCGGTTCTTGTTTTTCCAGGTTCGAATTGTGATAGAGACATGTTTAATGCT
    GCTATTAAAAGTGGTGTTGAAGCGGAATATGTAGATTATAGAGAAACATCACTAAGTGGA
    TTTGATGGCGTACTTATTCCTGGTGGATTTTCATTCGGGGATTACTTAAGATCTGGGGCA
    ATGGCTAGTGTAGCGCCGATTATTTCGGAAGTTAAACGTCTTGCAACTGAAGGTAAGCCA
    GTATTAGGTGTTTGTAATGGGTTTCAAATTTTAACTGAAATAGGCTTATTACCTGGTGCA
    TTATTGCATAACGATTCACATTTATTTATTAGTAGAAATGAAGAGTTAGAAATAGTGAAT
    AATCAAACGGCATTTACAAATCTTTATGAGCAAGGTGAAAAAGTTATATATCCTGTAGCT
    CACGGTGAAGGTCATTATTATTGTACTGATGAAATATATCAACAATTAAAAGCTAACAAT
    CAAATTATTCTGAAATATGTGAATAATCCGAACGGTTCATATGATGATATTGCAGGAATT
    GTTAACGAAAAAGGCAATGTATGTGGCATGATGCCACATCCTGAAAGAGCTTTAGAAACG
    TTGTTAGGTACTGATAGTGGTGTGAAATTATTTGAAGCGATGGTAAAAAGTTGGAGGGAA
    CAACATGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    672

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS05215 [old locus tag: SA0920 ]
  • symbol: SA_RS05215
  • description: phosphoribosylformylglycinamidine synthase subunit PurQ
  • length: 223
  • theoretical pI: 4.69597
  • theoretical MW: 24556.7
  • GRAVY: -0.120179

Function[edit source | edit]

  • reaction:
    EC 6.3.5.3?  ExPASy
    Phosphoribosylformylglycinamidine synthaseATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
    EC 3.5.1.2?  ExPASy
    GlutaminaseL-glutamine + H2O = L-glutamate + NH3
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 325.5)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase (TIGR01857; EC 6.3.5.3; HMM-score: 82.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase (TIGR01735; EC 6.3.5.3; HMM-score: 76.7)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesintracellular protease, PfpI family (TIGR01382; HMM-score: 26)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 25.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 22)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobyric acid synthase CobQ (TIGR00313; EC 6.3.5.10; HMM-score: 17.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisCTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 17.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 16.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesiscarbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 13.5)
  • TheSEED:
  • PFAM:
    Glutaminase_I (CL0014) GATase_5; CobB/CobQ-like glutamine amidotransferase domain (PF13507; HMM-score: 154.9)
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 33.1)
    DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 30.3)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 29.7)
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 15.9)
    SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.187
    • Ymax_pos: 21
    • Cmax: 0.156
    • Cmax_pos: 21
    • Smax: 0.291
    • Smax_pos: 12
    • Smean: 0.202
    • D: 0.193
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446589460 NCBI
  • RefSeq: WP_000666806 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLATEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS05215 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]