From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS07820 [old locus tag: SA1382 ]
  • pan locus tag?: SAUPAN004134000
  • symbol: SA_RS07820
  • pan gene symbol?: sodA
  • synonym:
  • product: superoxide dismutase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS07820 [old locus tag: SA1382 ]
  • symbol: SA_RS07820
  • product: superoxide dismutase
  • replicon: chromosome
  • strand: -
  • coordinates: 1588022..1588621
  • length: 600
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1588022..1588621) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGCTTTTGAATTACCAAAATTACCATACGCATTTGATGCATTAGAACCACATTTTGAC
    AAAGAAACTATGGAAATTCACCATGACAGACATCATAACACGTATGTTACGAAATTAAAT
    GCTGCAGTAGAAGGTACAGATTTAGAATCTAAATCTATTGAAGAAATTGTTGCTAATTTA
    GACAGTGTACCAGCTAACATCCAAACTGCTGTACGTAATAATGGCGGTGGACATTTAAAC
    CATTCATTATTCTGGGAGTTACTTTCACCAAACTCAGAAGAAAAAGGTACTGTAGTAGAA
    AAAATTAAAGAACAATGGGGTTCTTTAGAAGAATTTAAAAAAGAATTTGCTGACAAAGCA
    GCTGCACGCTTTGGTTCAGGTTGGGCTTGGTTAGTCGTAAACAATGGCCAGTTAGAAATT
    GTGACTACACCAAACCAAGATAATCCATTAACTGAGGGTAAAACACCTATTTTAGGTTTA
    GACGTATGGGAACACGCTTATTACCTAAAATATCAAAACAAACGCCCTGACTACATTGGC
    GCATTTTGGAATGTAGTTAACTGGGAAAAAGTTGACGAATTATATAATGCAACAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS07820 [old locus tag: SA1382 ]
  • symbol: SA_RS07820
  • description: superoxide dismutase
  • length: 199
  • theoretical pI: 4.8565
  • theoretical MW: 22711.2
  • GRAVY: -0.575879

Function[edit source | edit]

  • reaction:
    EC 1.15.1.1?  ExPASy
    Superoxide dismutase2 superoxide + 2 H+ = O2 + H2O2
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedSod_Fe_C; Iron/manganese superoxide dismutases, C-terminal domain (PF02777; HMM-score: 144.2)
    Sod_Fe_N; Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081; HMM-score: 119.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Fe2+, Mn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.72
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.106
    • Ymax_pos: 31
    • Cmax: 0.105
    • Cmax_pos: 53
    • Smax: 0.158
    • Smax_pos: 20
    • Smean: 0.094
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446786300 NCBI
  • RefSeq: WP_000863556 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKVDELYNATK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS07820 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]