From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10655 [old locus tag: SA1856 ]
  • pan locus tag?: SAUPAN005300000
  • symbol: SA_RS10655
  • pan gene symbol?:
  • synonym:
  • product: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS10655 [old locus tag: SA1856 ]
  • symbol: SA_RS10655
  • product: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB
  • replicon: chromosome
  • strand: -
  • coordinates: 2095977..2096639
  • length: 663
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2095977..2096639) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAATTCGCTGCTCATTGATACATCGAATCAACCATTATCAGTAGCATTGATGCAAAAC
    GATGAAGTTTTAGCTGAAATAACTACGGATTCTAAACAAAATCATTCAGTGCAATTAATG
    CCTGCGATTAGTCAGCTATTTGAGCAGAGCAAAATAGCTAAACAGCAATTAGATGCGATT
    ATTGTTGCTGAAGGTCCTGGTTCATATACTGGCTTACGTATCGGTGTTACTGTTGCTAAA
    ACATTAGCGTATGCGTTAGATGTTAAATTATATGGTGTTTCATCATTAAAGGCATTGGCA
    GCAACAATCGATCATACTGATAAATTATTGGTTCCTGTGTTTGATGCAAGACGACAAGCA
    GTTTATACAGGCATATTCCAGTGGCAAAATGGTCAATTAGTGACTATTTTAGAAGATCAA
    TATATGTCGATAGAGGCATTGCGAGCTTTTTTAGAAGATTTAAACCAACCATTTATTTAT
    ATTGGGAAAGATACTATAAAATTACAAGATGAATTACAAGGTGAAGTGATTGCGCAGCTA
    CCAAATGCATCAGTCATGTATCAATTGATAGATAAACCTACAGACGTACATACATTTACT
    CCTAAATACCATAAATTAGCTGAGGCGGAACGAAATTGGATCAACAGTCAAAAGAACAAT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    663

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS10655 [old locus tag: SA1856 ]
  • symbol: SA_RS10655
  • description: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB
  • length: 220
  • theoretical pI: 4.85595
  • theoretical MW: 24563.9
  • GRAVY: -0.121364

Function[edit source | edit]

  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein YeaZ (TIGR03725; HMM-score: 178.1)
    and 3 more
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein TsaD (TIGR03723; HMM-score: 44.2)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesmetallohydrolase, glycoprotease/Kae1 family (TIGR00329; HMM-score: 40)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairuniversal archaeal protein Kae1 (TIGR03722; HMM-score: 34.8)
  • TheSEED:
  • PFAM:
    Actin_ATPase (CL0108) Peptidase_M22; Glycoprotease family (PF00814; HMM-score: 108.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.233
    • Ymax_pos: 26
    • Cmax: 0.202
    • Cmax_pos: 26
    • Smax: 0.328
    • Smax_pos: 16
    • Smean: 0.223
    • D: 0.229
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447009481 NCBI
  • RefSeq: WP_001086737 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSKIAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLVPVFDARRQAVYTGIFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTIKLQDELQGEVIAQLPNASVMYQLIDKPTDVHTFTPKYHKLAEAERNWINSQKNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS10655 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]