From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS11505 [old locus tag: SA1999 ]
  • pan locus tag?: SAUPAN005595000
  • symbol: SA_RS11505
  • pan gene symbol?: cobB
  • synonym:
  • product: NAD-dependent protein deacylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS11505 [old locus tag: SA1999 ]
  • symbol: SA_RS11505
  • product: NAD-dependent protein deacylase
  • replicon: chromosome
  • strand: +
  • coordinates: 2270390..2271130
  • length: 741
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2270390..2271130) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGTTTATTTTGAGAAATGATTTAGAGACATTAAAACATATTATAGATAGTTCGAATCGT
    ATTACATTTTTCACAGGTGCTGGTGTATCTGTCGCAAGTGGCGTTCCAGATTTCCGTTCA
    ATGGGTGGCTTATTTGATGAAATTTCAAAAGATGGACTTTCGCCAGAATACTTGTTAAGC
    CGTGATTATTTAGAAGATGATCCTGAAGGTTTTATCAATTTCTGCCATAAGCGTTTACTA
    TTTGTCGATACGAAGCCTAATATCGTTCATGATTGGATTGCAAAATTAGAACGTAATCAA
    CAATCTTTAGGTGTCATCACGCAAAATATCGATGGTTTGCACTCAGACGCTGGAAGTCAA
    CATGTTGATGAATTACATGGCACGTTAAATCGTTTTTATTGTAATGCATGTCATAAATCT
    TATACGAAGTCAGATGTTATTGATAGAACTTTGAAACATTGTGATAATTGTGGTGGTGCC
    ATTCGACCGGACATCGTATTATACGGTGAAATGTTAGATCAACCTACCATCATAAGGGCA
    TTAAATAAAATTGAACATGCTGACACCCTTGTTGTACTAGGTTCATCACTCGTTGTACAA
    CCTGCCGCAGGATTAATATCACATTTTAAAGGCGACAATTTAATTATTATCAATAAAGAT
    CGAACACCTTATGATAGCGACGCTACTTTGGTCATACATGACGACATGGTTTCCGTTGTA
    AAATCATTAATGACAGAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS11505 [old locus tag: SA1999 ]
  • symbol: SA_RS11505
  • description: NAD-dependent protein deacylase
  • length: 246
  • theoretical pI: 5.28239
  • theoretical MW: 27398.9
  • GRAVY: -0.142683

Function[edit source | edit]

  • reaction:
    EC 3.5.1.-?  ExPASy
    NAD+ + an acetylprotein = nicotinamide + O-acetyl-ADP-ribose + a protein?
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsputative regulatory protein, FmdB family (TIGR02605; HMM-score: 11.8)
  • TheSEED:
  • PFAM:
    FAD_DHS (CL0085) SIR2; Sir2 family (PF02146; HMM-score: 184.8)
    Zn_Beta_Ribbon (CL0167) Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 13.7)
    Nudix_N_2; Nudix N-terminal (PF14803; HMM-score: 12.7)
    Multiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 11.6)
    Zn_Beta_Ribbon (CL0167) zf-TFIIB; Transcription factor zinc-finger (PF13453; HMM-score: 10.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.153
    • Ymax_pos: 33
    • Cmax: 0.159
    • Cmax_pos: 33
    • Smax: 0.201
    • Smax_pos: 26
    • Smean: 0.149
    • D: 0.151
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001557494 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFILRNDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLSRDYLEDDPEGFINFCHKRLLFVDTKPNIVHDWIAKLERNQQSLGVITQNIDGLHSDAGSQHVDELHGTLNRFYCNACHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRALNKIEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVVKSLMTE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS11505 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]