From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13110 [old locus tag: SA2286 ]
  • pan locus tag?: SAUPAN006109000
  • symbol: SA_RS13110
  • pan gene symbol?: sarT
  • synonym:
  • product: transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS13110 [old locus tag: SA2286 ]
  • symbol: SA_RS13110
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2564122..2564442
  • length: 321
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2564122..2564442) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAGAGTATTAACTACATATGAGCTGCGTAAATATTTAAAAAAATATTTTTGTCTT
    ACATTAGATAATTATTTAGTATTAGCATATTTAGATGTATTTAAAAATGATGAAGGTAAA
    TATTTTATGAGAGACATTATAAGTTATATCGGTATAGACCAATCTAGAATTGTTAAAAGC
    GTAAAAGAATTATCAAAAAAGGGTTACTTGAATAAATGTAGAGACCCACATGATAGTAGA
    AATGTAATCATTGTTGTTTCTGTAAAACAACACAATTATATTAAAAATCTTTTGAGTGAA
    ATAAATATTAATGAAACATAA
    60
    120
    180
    240
    300
    321

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS13110 [old locus tag: SA2286 ]
  • symbol: SA_RS13110
  • description: transcriptional regulator
  • length: 106
  • theoretical pI: 9.79423
  • theoretical MW: 12629.7
  • GRAVY: -0.345283

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 114.6)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.2)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 29.4)
    MarR_2; MarR family (PF12802; HMM-score: 26.9)
    MarR; MarR family (PF01047; HMM-score: 21.1)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 19)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.3)
    B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.145
    • Ymax_pos: 12
    • Cmax: 0.108
    • Cmax_pos: 36
    • Smax: 0.312
    • Smax_pos: 5
    • Smean: 0.217
    • D: 0.173
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_069993647 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDIISYIGIDQSRIVKSVKELSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS13110 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]