From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000422 [new locus tag: EGJ38_RS02105 ]
  • pan locus tag?: SAUPAN002217000
  • symbol: darA
  • pan gene symbol?: darA
  • synonym: pstA
  • alternate name: JSNZ_000422
  • product: cyclic-di-AMP receptor

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000422 [new locus tag: EGJ38_RS02105 ]
  • symbol: darA
  • product: cyclic-di-AMP receptor
  • replicon: chromosome
  • strand: +
  • coordinates: 456155..456484
  • length: 330
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422418 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATGATTATAGCGATCGTACAAGATCAAGATAGTCAGGAACTTGCAGATCAACTT
    GTTAAAAATAACTTTAGAGCAACAAAATTGGCAACAACAGGTGGGTTTTTAAGAGCGGGT
    AATACAACATTCTTATGTGGTGTCAATGATGACCGTGTAGATGAAATATTGTCTGTGATT
    AATCAAACGTGTGGTAATAGAGAACAGTTGGTTTCACCTATTACACCTATGGGAGGCAGT
    GCGGATTCGTACATTCCATATCCAGTTGAAGTTGAAGTTGGCGGTGCTACTGTATTTGTT
    ATGCCAGTTGATGCATTCCATCAATTTTAA
    60
    120
    180
    240
    300
    330

Protein[edit | edit source]

Protein Data Bank: 4WK1
Protein Data Bank: 4WK3
Protein Data Bank: 4D3G
Protein Data Bank: 4D3H

General[edit | edit source]

  • locus tag: EGJ38_000422 [new locus tag: EGJ38_RS02105 ]
  • symbol: DarA
  • description: cyclic-di-AMP receptor
  • length: 109
  • theoretical pI: 4.21092
  • theoretical MW: 11838.4
  • GRAVY: 0.0422018

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    GlnB-like (CL0089) CdAMP_rec; Cyclic-di-AMP receptor (PF06153; HMM-score: 183.4)
    and 1 more
    P-II; Nitrogen regulatory protein P-II (PF00543; HMM-score: 16.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9792
    • Cytoplasmic Membrane Score: 0.0095
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0112
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.047234
    • TAT(Tat/SPI): 0.008151
    • LIPO(Sec/SPII): 0.00179
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422418 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVDAFHQF

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Rebecca M Corrigan, Ivan Campeotto, Tharshika Jeganathan, Kevin G Roelofs, Vincent T Lee, Angelika Gründling
Systematic identification of conserved bacterial c-di-AMP receptor proteins.
Proc Natl Acad Sci U S A: 2013, 110(22);9084-9
[PubMed:23671116] [WorldCat.org] [DOI] (I p)