Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS02105 [old locus tag: EGJ38_000422 ]
- pan locus tag?: SAUPAN002217000
- symbol: EGJ38_RS02105
- pan gene symbol?: darA
- synonym: pstA
- product: cyclic-di-AMP receptor
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS02105 [old locus tag: EGJ38_000422 ]
- symbol: EGJ38_RS02105
- product: cyclic-di-AMP receptor
- replicon: chromosome
- strand: +
- coordinates: 456155..456484
- length: 330
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (456155..456484) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAATGATTATAGCGATCGTACAAGATCAAGATAGTCAGGAACTTGCAGATCAACTT
GTTAAAAATAACTTTAGAGCAACAAAATTGGCAACAACAGGTGGGTTTTTAAGAGCGGGT
AATACAACATTCTTATGTGGTGTCAATGATGACCGTGTAGATGAAATATTGTCTGTGATT
AATCAAACGTGTGGTAATAGAGAACAGTTGGTTTCACCTATTACACCTATGGGAGGCAGT
GCGGATTCGTACATTCCATATCCAGTTGAAGTTGAAGTTGGCGGTGCTACTGTATTTGTT
ATGCCAGTTGATGCATTCCATCAATTTTAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS02105 [old locus tag: EGJ38_000422 ]
- symbol: EGJ38_RS02105
- description: cyclic-di-AMP receptor
- length: 109
- theoretical pI: 4.21092
- theoretical MW: 11838.4
- GRAVY: 0.0422018
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: GlnB-like (CL0089) CdAMP_rec; Cyclic-di-AMP receptor (PF06153; HMM-score: 183.4)and 1 moreP-II; Nitrogen regulatory protein P-II (PF00543; HMM-score: 16.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9792
- Cytoplasmic Membrane Score: 0.0095
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0112
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.047234
- TAT(Tat/SPI): 0.008151
- LIPO(Sec/SPII): 0.00179
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000781979 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVDAFHQF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]