Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000552 [new locus tag: EGJ38_RS02755 ]
- pan locus tag?: SAUPAN002438000
- symbol: hypR
- pan gene symbol?: hypR
- synonym:
- alternate name: JSNZ_000552
- product: redox-sensitive transcriptional regulator HypR
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000552 [new locus tag: EGJ38_RS02755 ]
- symbol: hypR
- product: redox-sensitive transcriptional regulator HypR
- replicon: chromosome
- strand: -
- coordinates: 593625..594065
- length: 441
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422532 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421TTGAATTTAGAATTTAACATTGCCGTGCATGTATTAGCTTTTTTAACTAAGCATCATTCA
GAAAAATTCAATAGTAGTTCATTAGCAGAATTAACTTGTTTAAATCCTGTTCAATTACGA
CGCGTGACGACTCAACTTGTCGATTTAAAAATGATTAACACAATACGGGGTAAAGATGGT
GGATATTTAGCAAATGATCGTAGCGCTGATGTCTCTTTAGCAACATTATATAAACATTTT
GTCTTAGAGAAAGAACATCACACACGACTATTTACTGGCGACGAAGGCAGTCACTGTCAA
ATTGCTCGTAATATTGCAACTACCATGTCTCATTATCAACAAGACGAACAGAATATCATT
ATTAATTTTTATAAAGAAAAAACAATCAAAGATGTCATTGAAGACATTCAAAAGGAGGAT
TTATGTCATGAAAACATATGA60
120
180
240
300
360
420
441
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000552 [new locus tag: EGJ38_RS02755 ]
- symbol: HypR
- description: redox-sensitive transcriptional regulator HypR
- length: 146
- theoretical pI: 6.59784
- theoretical MW: 16812
- GRAVY: -0.39863
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 39.6)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 33)Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 33)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 20.4)Regulatory functions DNA interactions iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 20.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 59.3)and 2 moreTFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 14.1)HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9744
- Cytoplasmic Membrane Score: 0.0049
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.0199
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019758
- TAT(Tat/SPI): 0.001631
- LIPO(Sec/SPII): 0.003477
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422532 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNLEFNIAVHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMINTIRGKDGGYLANDRSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNIIINFYKEKTIKDVIEDIQKEDLCHENI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)