Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0577 [new locus tag: SAUSA300_RS03085 ]
- pan locus tag?: SAUPAN002438000
- symbol: SAUSA300_0577
- pan gene symbol?: hypR
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0577 [new locus tag: SAUSA300_RS03085 ]
- symbol: SAUSA300_0577
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 651567..651983
- length: 417
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914421 NCBI
- RefSeq: YP_493280 NCBI
- BioCyc: see SAUSA300_RS03085
- MicrobesOnline: 1292092 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361GTGCATGTATTAGCTTTTTTAACTAAGCATCATTCAGAAAAATTCAATAGTAGTTCATTA
GCAGAATTAACTTGTTTAAATCCTGTTCAATTACGACGCGTGACGACTCAACTTGTCGAT
TTAAAAATGATTGACACAATACGAGGTAAAGATGGCGGTTATTTAGCAAATGATCAAAGT
GCTGATGTCTCTCTAGCAACATTATATAAACATTTTGTCTTAGAGAAAGAACACCACACA
CGTCTATTTACTGGCGACGAAGGCAGTCACTGTCAAATTGCTCGTAATATTGCAACTACC
ATGTCACATTATCAGCAAGACGAACAGAATATCATTATTAATTTTTATAATGGAAAAACA
ATCAAAGATGTCATTGAAGACATTCAAAAGGAGGATTTATGTCATGAAAACATATGA60
120
180
240
300
360
417
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0577 [new locus tag: SAUSA300_RS03085 ]
- symbol: SAUSA300_0577
- description: hypothetical protein
- length: 138
- theoretical pI: 6.41167
- theoretical MW: 15797.8
- GRAVY: -0.436957
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 33.7)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 30.6)Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 30.6)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 20.7)Regulatory functions DNA interactions iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 20.7)
- TheSEED :
- hypothetical fig|282458.1.peg.572 homolog
- PFAM: HTH (CL0123) Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 50.8)and 3 moreTFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 14.1)HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 13.4)Put_DNA-bind_N; Putative DNA-binding protein N-terminus (PF06971; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9747
- Cytoplasmic Membrane Score: 0.0137
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0113
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005182
- TAT(Tat/SPI): 0.000542
- LIPO(Sec/SPII): 0.001482
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDGGYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNIIINFYNGKTIKDVIEDIQKEDLCHENI
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]