Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000933 [new locus tag: EGJ38_RS04660 ]
- pan locus tag?: SAUPAN003080000
- symbol: EGJ38_000933
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000933
- product: YisL family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000933 [new locus tag: EGJ38_RS04660 ]
- symbol: EGJ38_000933
- product: YisL family protein
- replicon: chromosome
- strand: +
- coordinates: 935468..935857
- length: 390
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422904 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTACATTTACATATATTAAGTTGGGTATTAGCGATTATTTTATTTATCGCTACATAC
TTAAACATTTCAAAAAATCAAGGTGGTACGCCATATTTCAAACCGTTGCACATGATTTTA
CGCTTATTTATGCTGTTGACGTTAATTTCAGGATTTTGGATATTAATTCAGTCATTTATG
AATGGCGGGGCAAATCATATGTTGCTTACATTGAAAATGCTGTGTGGTGTTGCAGTAGTT
GGATTGATGGAAGTGTCGATTGCTAAAAGAAAGAGACATGAACAAAGTCACACAATGTTT
TGGATAACAATTGCATTAATTATCATCACAATGGTATTAGGTGTCATTCTACCGTTAGGG
CCTATATCAAAATTATTCGGTATTGGCTAA60
120
180
240
300
360
390
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000933 [new locus tag: EGJ38_RS04660 ]
- symbol: EGJ38_000933
- description: YisL family protein
- length: 129
- theoretical pI: 10.8676
- theoretical MW: 14469.8
- GRAVY: 1.03566
⊟Function[edit | edit source]
- TIGRFAM: MSEP-CTERM protein (TIGR04286; HMM-score: 13.8)and 2 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 9.5)oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 6.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 112.1)and 11 moreSirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 18.6)no clan defined SPW; SPW repeat domain (PF03779; HMM-score: 15.4)GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 14.5)no clan defined DUF3681; Protein of unknown function (DUF3681) (PF12442; HMM-score: 13.7)MASE6; MASE6 (PF20966; HMM-score: 12.2)DUF7649; Domain of unknown function (DUF7649) (PF24661; HMM-score: 11.6)TgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 11.5)DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 11.1)Ninjurin; Ninjurin (PF04923; HMM-score: 9.1)DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 8)PalH; PalH/RIM21 (PF08733; HMM-score: 6.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010232
- TAT(Tat/SPI): 0.000199
- LIPO(Sec/SPII): 0.045037
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422904 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLGPISKLFGIG
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]