From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0830 [new locus tag: SA_RS04715 ]
  • pan locus tag?: SAUPAN003080000
  • symbol: SA0830
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0830 [new locus tag: SA_RS04715 ]
  • symbol: SA0830
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 940904..941293
  • length: 390
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTACATTTACATATATTAAGTTGGGTATTAGCGATTATTTTATTTATCGCTACATAC
    TTAAACATTTCAAAAAATCAAGGCGGATCACCATTTTTCAAACCGTTGCACATGATTTTA
    CGCTTATTTATGCTGTTGACGTTAATTTCAGGATTTTGGATATTAATTCAGTCATTTATG
    AATGGCGGGGCAAATCATATGTTGCTTACATTGAAAATGCTGTGTGGTGTTGCAGTAGTT
    GGATTGATGGAAGTGTCGATTGCTAAAAGAAAGAGACATGAACAAAGTCACAAAATGTTT
    TGGATAACAATGGCATTAATTATCATCACAATGGTATTAGGTGTCATTCTACCGTTAGGG
    CCTATATCAAAATTATTCGGTATTGGCTAA
    60
    120
    180
    240
    300
    360
    390


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0830 [new locus tag: SA_RS04715 ]
  • symbol: SA0830
  • description: hypothetical protein
  • length: 129
  • theoretical pI: 11.181
  • theoretical MW: 14484.9
  • GRAVY: 1.02171

Function[edit | edit source]

  • TIGRFAM:
    MSEP-CTERM protein (TIGR04286; HMM-score: 14.1)
    and 2 more
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 9.8)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 6.3)
  • TheSEED  :
    • Uncharacterized protein UPF0344
    Cofactors, Vitamins, Prosthetic Groups, Pigments Tetrapyrroles CPO analysis  Uncharacterized protein UPF0344
  • PFAM:
    CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 110.7)
    and 12 more
    SirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 18.8)
    GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 16.6)
    no clan defined DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 13.8)
    SPW; SPW repeat domain (PF03779; HMM-score: 13.3)
    MASE6; MASE6 (PF20966; HMM-score: 12.6)
    TgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 12)
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 10.6)
    no clan defined Ninjurin; Ninjurin (PF04923; HMM-score: 10.1)
    DUF420; Protein of unknown function (DUF420) (PF04238; HMM-score: 9.7)
    DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 9)
    EMP70; Endomembrane protein 70 (PF02990; HMM-score: 6.5)
    PalH; PalH/RIM21 (PF08733; HMM-score: 5.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9992
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0008
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008257
    • TAT(Tat/SPI): 0.000172
    • LIPO(Sec/SPII): 0.035211
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLGPISKLFGIG

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]