Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0830 [new locus tag: SA_RS04715 ]
- pan locus tag?: SAUPAN003080000
- symbol: SA0830
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0830 [new locus tag: SA_RS04715 ]
- symbol: SA0830
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 940904..941293
- length: 390
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123645 NCBI
- RefSeq: NP_374091 NCBI
- BioCyc: see SA_RS04715
- MicrobesOnline: 103117 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTACATTTACATATATTAAGTTGGGTATTAGCGATTATTTTATTTATCGCTACATAC
TTAAACATTTCAAAAAATCAAGGCGGATCACCATTTTTCAAACCGTTGCACATGATTTTA
CGCTTATTTATGCTGTTGACGTTAATTTCAGGATTTTGGATATTAATTCAGTCATTTATG
AATGGCGGGGCAAATCATATGTTGCTTACATTGAAAATGCTGTGTGGTGTTGCAGTAGTT
GGATTGATGGAAGTGTCGATTGCTAAAAGAAAGAGACATGAACAAAGTCACAAAATGTTT
TGGATAACAATGGCATTAATTATCATCACAATGGTATTAGGTGTCATTCTACCGTTAGGG
CCTATATCAAAATTATTCGGTATTGGCTAA60
120
180
240
300
360
390
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0830 [new locus tag: SA_RS04715 ]
- symbol: SA0830
- description: hypothetical protein
- length: 129
- theoretical pI: 11.181
- theoretical MW: 14484.9
- GRAVY: 1.02171
⊟Function[edit | edit source]
- TIGRFAM: MSEP-CTERM protein (TIGR04286; HMM-score: 14.1)and 2 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 9.8)oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 6.3)
- TheSEED :
- Uncharacterized protein UPF0344
- PFAM: CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 110.7)and 12 moreSirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 18.8)GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 16.6)no clan defined DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 13.8)SPW; SPW repeat domain (PF03779; HMM-score: 13.3)MASE6; MASE6 (PF20966; HMM-score: 12.6)TgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 12)Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 10.6)no clan defined Ninjurin; Ninjurin (PF04923; HMM-score: 10.1)DUF420; Protein of unknown function (DUF420) (PF04238; HMM-score: 9.7)DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 9)EMP70; Endomembrane protein 70 (PF02990; HMM-score: 6.5)PalH; PalH/RIM21 (PF08733; HMM-score: 5.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9992
- Cell wall & surface Score: 0
- Extracellular Score: 0.0008
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008257
- TAT(Tat/SPI): 0.000172
- LIPO(Sec/SPII): 0.035211
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLGPISKLFGIG
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]