From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0974 [new locus tag: SACOL_RS04985 ]
  • pan locus tag?: SAUPAN003080000
  • symbol: SACOL0974
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0974 [new locus tag: SACOL_RS04985 ]
  • symbol: SACOL0974
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 980509..980898
  • length: 390
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTACATTTACATATATTAAGTTGGGTATTAGCGATTATTTTATTTATCGCTACATAC
    TTAAACATTTCAAAAAATCAAGGCAGATCACCATTTTTCAAACCGTTGCACATGATTTTA
    CGCTTATTTATGCTGTTGACGTTAATTTCAGGATTTTGGATATTAATTCAGTCATTTATG
    AATGGCGGGGCAAATCATATGTTGCTTACATTGAAAATGCTGTGTGGTGTTGCAGTAGTT
    GGATTGATGGAAGTGTCGATTGCTAAAAGAAAGAGACATGAACAAAGTCACACAATGTTT
    TGGATAACAATCGCATTAATTATCATCACAATGGTATTAGGTGTCATTCTACCGTTAGGG
    CCTATATCAAAATTATTCGGTATTGGCTAA
    60
    120
    180
    240
    300
    360
    390

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0974 [new locus tag: SACOL_RS04985 ]
  • symbol: SACOL0974
  • description: hypothetical protein
  • length: 129
  • theoretical pI: 11.3868
  • theoretical MW: 14538.9
  • GRAVY: 1.03488

Function[edit | edit source]

  • TIGRFAM:
    MSEP-CTERM protein (TIGR04286; HMM-score: 14.1)
    and 3 more
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 9.9)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 7.6)
    XrtN system VIT domain protein (TIGR04477; HMM-score: 2.7)
  • TheSEED  :
    • Uncharacterized protein UPF0344
    Cofactors, Vitamins, Prosthetic Groups, Pigments Tetrapyrroles CPO analysis  Uncharacterized protein UPF0344
  • PFAM:
    CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 113.2)
    and 13 more
    SirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 19.3)
    no clan defined SPW; SPW repeat domain (PF03779; HMM-score: 15.4)
    GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 14.3)
    no clan defined DUF3681; Protein of unknown function (DUF3681) (PF12442; HMM-score: 13.6)
    DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 12.1)
    TgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 11.2)
    DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 9.8)
    Ninjurin; Ninjurin (PF04923; HMM-score: 9.2)
    DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 9.2)
    Marvel-like (CL0396) MARVEL; Membrane-associating domain (PF01284; HMM-score: 8.7)
    no clan defined MASE6; MASE6 (PF20966; HMM-score: 8.1)
    PalH; PalH/RIM21 (PF08733; HMM-score: 7.1)
    DUF5373; Family of unknown function (DUF5373) (PF17343; HMM-score: 7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9994
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0006
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006761
    • TAT(Tat/SPI): 0.000206
    • LIPO(Sec/SPII): 0.030199
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLGPISKLFGIG

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]