Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS04985 [old locus tag: SACOL0974 ]
- pan locus tag?: SAUPAN003080000
- symbol: SACOL_RS04985
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS04985 [old locus tag: SACOL0974 ]
- symbol: SACOL_RS04985
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 980509..980898
- length: 390
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTACATTTACATATATTAAGTTGGGTATTAGCGATTATTTTATTTATCGCTACATAC
TTAAACATTTCAAAAAATCAAGGCAGATCACCATTTTTCAAACCGTTGCACATGATTTTA
CGCTTATTTATGCTGTTGACGTTAATTTCAGGATTTTGGATATTAATTCAGTCATTTATG
AATGGCGGGGCAAATCATATGTTGCTTACATTGAAAATGCTGTGTGGTGTTGCAGTAGTT
GGATTGATGGAAGTGTCGATTGCTAAAAGAAAGAGACATGAACAAAGTCACACAATGTTT
TGGATAACAATCGCATTAATTATCATCACAATGGTATTAGGTGTCATTCTACCGTTAGGG
CCTATATCAAAATTATTCGGTATTGGCTAA60
120
180
240
300
360
390
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS04985 [old locus tag: SACOL0974 ]
- symbol: SACOL_RS04985
- description: hypothetical protein
- length: 129
- theoretical pI: 11.3868
- theoretical MW: 14538.9
- GRAVY: 1.03488
⊟Function[edit | edit source]
- TIGRFAM: MSEP-CTERM protein (TIGR04286; HMM-score: 14.1)and 3 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 9.9)oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 7.6)XrtN system VIT domain protein (TIGR04477; HMM-score: 2.7)
- TheSEED: see SACOL0974
- PFAM: CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 113.2)and 13 moreSirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 19.3)no clan defined SPW; SPW repeat domain (PF03779; HMM-score: 15.4)GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 14.3)no clan defined DUF3681; Protein of unknown function (DUF3681) (PF12442; HMM-score: 13.6)DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 12.1)TgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 11.2)DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 9.8)Ninjurin; Ninjurin (PF04923; HMM-score: 9.2)DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 9.2)Marvel-like (CL0396) MARVEL; Membrane-associating domain (PF01284; HMM-score: 8.7)no clan defined MASE6; MASE6 (PF20966; HMM-score: 8.1)PalH; PalH/RIM21 (PF08733; HMM-score: 7.1)DUF5373; Family of unknown function (DUF5373) (PF17343; HMM-score: 7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006761
- TAT(Tat/SPI): 0.000206
- LIPO(Sec/SPII): 0.030199
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLGPISKLFGIG
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.