From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001073 [new locus tag: EGJ38_RS05360 ]
  • pan locus tag?: SAUPAN003335000
  • symbol: EGJ38_001073
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_001073
  • product: DUF5325 family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001073 [new locus tag: EGJ38_RS05360 ]
  • symbol: EGJ38_001073
  • product: DUF5325 family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1077460..1077651
  • length: 192
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423042 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAACAAAAAAAATCTAAAAATATCTTTTGGGTATTTTCTATATTAGCTGTTGTTTTC
    TTAGTATTATTTAGTTTTGCTGTTGGTGCATCAAATGTACCAATGATGATTTTAACATTT
    ATATTACTCGTTGCAACCTTTGGAATTGGATTTACTACAAAGAAAAAATATCGAGAAAAC
    GATTGGCTATAA
    60
    120
    180
    192

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001073 [new locus tag: EGJ38_RS05360 ]
  • symbol: EGJ38_001073
  • description: DUF5325 family protein
  • length: 63
  • theoretical pI: 10.9505
  • theoretical MW: 7249.77
  • GRAVY: 0.779365

Function[edit | edit source]

  • TIGRFAM:
    early transcribed membrane protein (ETRAMP) family (TIGR01495; HMM-score: 14.6)
    Cell structure Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 12.7)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 12.5)
    and 1 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 6.5)
  • TheSEED: data available for COL, N315, USA300_FPR3757
  • PFAM:
    no clan defined DUF5325; Family of unknown function (DUF5325) (PF17259; HMM-score: 47)
    and 11 more
    DUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 18.1)
    DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 15.5)
    ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 14.9)
    DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 14.2)
    DUF5392; Family of unknown function (DUF5392) (PF17370; HMM-score: 14)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13.3)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 12.5)
    DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 12.1)
    DUF6520; Family of unknown function (DUF6520) (PF20130; HMM-score: 10.7)
    SNARE-fusion (CL0445) SNARE; SNARE domain (PF05739; HMM-score: 10.1)
    no clan defined DUF6480; Family of unknown function (DUF6480) (PF20088; HMM-score: 7.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.941
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0588
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.078075
    • TAT(Tat/SPI): 0.005197
    • LIPO(Sec/SPII): 0.052512
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423042 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYRENDWL

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]