Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS05360 [old locus tag: EGJ38_001073 ]
- pan locus tag?: SAUPAN003335000
- symbol: EGJ38_RS05360
- pan gene symbol?: —
- synonym:
- product: DUF5325 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS05360 [old locus tag: EGJ38_001073 ]
- symbol: EGJ38_RS05360
- product: DUF5325 family protein
- replicon: chromosome
- strand: -
- coordinates: 1077460..1077651
- length: 192
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1077460..1077651) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAACAAAAAAAATCTAAAAATATCTTTTGGGTATTTTCTATATTAGCTGTTGTTTTC
TTAGTATTATTTAGTTTTGCTGTTGGTGCATCAAATGTACCAATGATGATTTTAACATTT
ATATTACTCGTTGCAACCTTTGGAATTGGATTTACTACAAAGAAAAAATATCGAGAAAAC
GATTGGCTATAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS05360 [old locus tag: EGJ38_001073 ]
- symbol: EGJ38_RS05360
- description: DUF5325 family protein
- length: 63
- theoretical pI: 10.9505
- theoretical MW: 7249.77
- GRAVY: 0.779365
⊟Function[edit | edit source]
- TIGRFAM: early transcribed membrane protein (ETRAMP) family (TIGR01495; HMM-score: 14.6)Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 12.7)cxxc_20_cxxc protein (TIGR04104; HMM-score: 12.5)and 1 moreProtein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 6.5)
- TheSEED: data available for COL, N315, USA300_FPR3757
- PFAM: no clan defined DUF5325; Family of unknown function (DUF5325) (PF17259; HMM-score: 47)and 11 moreDUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 18.1)DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 15.5)ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 14.9)DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 14.2)DUF5392; Family of unknown function (DUF5392) (PF17370; HMM-score: 14)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13.3)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 12.5)DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 12.1)DUF6520; Family of unknown function (DUF6520) (PF20130; HMM-score: 10.7)SNARE-fusion (CL0445) SNARE; SNARE domain (PF05739; HMM-score: 10.1)no clan defined DUF6480; Family of unknown function (DUF6480) (PF20088; HMM-score: 7.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.941
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0588
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.078075
- TAT(Tat/SPI): 0.005197
- LIPO(Sec/SPII): 0.052512
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000810620 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYRENDWL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]