⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001615 [new locus tag: EGJ38_RS08065 ]
- pan locus tag?: SAUPAN004228000
- symbol: cymR
- pan gene symbol?: cymR
- synonym:
- alternate name: JSNZ_001615
- product: Rrf2 family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001615 [new locus tag: EGJ38_RS08065 ]
- symbol: cymR
- product: Rrf2 family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1650297..1650719
- length: 423
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423572 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAATTTCTACTAAAGGGAGATATGGACTTACATTGATGATTTCTCTTGCTAAAAAA
GAGGGGCAAGGATGTATATCATTAAAGTCAATTGCTGAAGAAAATAATTTGAGTGATTTA
TATTTAGAACAGCTTGTAGGTCCTTTAAGAAATGCGGGGTTAATTCGAAGTGTACGCGGT
GCTAAAGGTGGATACCAATTAAGAGTACCAGCGGAAGAAATCTCAGCAGGGGATATTATA
AGACTGTTAGAAGGTCCAATTACATTTGTTGAAAGTATTGAATCAGAACCACCTGCGCAA
AAACAACTATGGATTCGCATGAGAGATGCAGTGAGAGATGTTTTAGATAATACAACATTG
AAATATTTAGCGGAATATGTAGATACAAGTGAAGATTTAGACGGATACATGTTTTATATT
TAA60
120
180
240
300
360
420
423
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001615 [new locus tag: EGJ38_RS08065 ]
- symbol: CymR
- description: Rrf2 family transcriptional regulator
- length: 140
- theoretical pI: 4.79134
- theoretical MW: 15642.9
- GRAVY: -0.175
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 108.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)Regulatory functions DNA interactions iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 121.7)and 1 moreHrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 17.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors: CysK (cysteine synthetase); O-acetyl-L-serine
- genes regulated by CymR, TF important in Cysteine metabolismsee RegPrecise for N315
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9772
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0212
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.065604
- TAT(Tat/SPI): 0.001286
- LIPO(Sec/SPII): 0.06428
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423572 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRGAKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTLKYLAEYVDTSEDLDGYMFYI
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Olga Soutourina, Olivier Poupel, Jean-Yves Coppée, Antoine Danchin, Tarek Msadek, Isabelle Martin-Verstraete
CymR, the master regulator of cysteine metabolism in Staphylococcus aureus, controls host sulphur source utilization and plays a role in biofilm formation.
Mol Microbiol: 2009, 73(2);194-211
[PubMed:19508281] [WorldCat.org] [DOI] (I p)Olga Soutourina, Sarah Dubrac, Olivier Poupel, Tarek Msadek, Isabelle Martin-Verstraete
The pleiotropic CymR regulator of Staphylococcus aureus plays an important role in virulence and stress response.
PLoS Pathog: 2010, 6(5);e1000894
[PubMed:20485570] [WorldCat.org] [DOI] (I e)