From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1453 [new locus tag: SA_RS08190 ]
  • pan locus tag?: SAUPAN004228000
  • symbol: SA1453
  • pan gene symbol?: cymR
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1453 [new locus tag: SA_RS08190 ]
  • symbol: SA1453
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1657620..1658042
  • length: 423
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAATTTCTACTAAAGGGAGATATGGACTTACATTGATGATTTCTCTTGCTAAAAAA
    GAGGGGCAAGGATGTATATCATTAAAGTCAATTGCTGAAGAAAATAATTTGAGTGATTTA
    TATTTAGAACAGCTTGTAGGTCCTTTAAGAAATGCGGGGTTAATTCGAAGTGTACGCGGT
    GCTAAAGGTGGATACCAATTAAGAGTACCAGCGGAAGAAATCTCAGCAGGGGATATTATA
    AGACTGTTAGAAGGTCCAATTACATTTGTTGAAAGTATTGAATCAGAACCACCTGCGCAA
    AAACAACTATGGATTCGCATGAGAGATGCAGTGAGAGATGTTTTAGATAATACAACATTG
    AAATATTTAGCGGAATATGTAGATACAAGTGAAGATTTAGACGGATACATGTTTTATATT
    TAA
    60
    120
    180
    240
    300
    360
    420
    423

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1453 [new locus tag: SA_RS08190 ]
  • symbol: SA1453
  • description: hypothetical protein
  • length: 140
  • theoretical pI: 4.79134
  • theoretical MW: 15642.9
  • GRAVY: -0.175

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 108.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)
    Signal transduction Regulatory functions DNA interactions iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)
    and 2 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)
    Signal transduction Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)
  • TheSEED  :
    • Iron-sulfur cluster regulator IscR
    RNA Metabolism Transcription Rrf2 family transcriptional regulators  Iron-sulfur cluster regulator IscR
    and 2 more
    Stress Response Stress Response - no subcategory Flavohaemoglobin  Iron-sulfur cluster regulator IscR
    Sulfur Metabolism Organic sulfur assimilation At5g37530 (CsdL protein family)  Iron-sulfur cluster regulator IscR
  • PFAM:
    HTH (CL0123) Rrf2; Transcriptional regulator (PF02082; HMM-score: 94)
    and 3 more
    HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 17.8)
    MarR_2; MarR family (PF12802; HMM-score: 12.8)
    no clan defined PPO1_DWL; Polyphenol oxidase middle domain (PF12142; HMM-score: 12.1)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.065604
    • TAT(Tat/SPI): 0.001286
    • LIPO(Sec/SPII): 0.06428
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRGAKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTLKYLAEYVDTSEDLDGYMFYI

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SA1453 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Olga Soutourina, Olivier Poupel, Jean-Yves Coppée, Antoine Danchin, Tarek Msadek, Isabelle Martin-Verstraete
CymR, the master regulator of cysteine metabolism in Staphylococcus aureus, controls host sulphur source utilization and plays a role in biofilm formation.
Mol Microbiol: 2009, 73(2);194-211
[PubMed:19508281] [WorldCat.org] [DOI] (I p)
Olga Soutourina, Sarah Dubrac, Olivier Poupel, Tarek Msadek, Isabelle Martin-Verstraete
The pleiotropic CymR regulator of Staphylococcus aureus plays an important role in virulence and stress response.
PLoS Pathog: 2010, 6(5);e1000894
[PubMed:20485570] [WorldCat.org] [DOI] (I e)