From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01732
  • pan locus tag?: SAUPAN004228000
  • symbol: SAOUHSC_01732
  • pan gene symbol?: cymR
  • synonym:
  • product:

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01732
  • symbol: SAOUHSC_01732
  • product:
  • replicon: chromosome
  • strand: -
  • coordinates: 1636131..1636554
  • length: 423
  • essential: no DEG other strains
  • comment: The sequence of SAOUHSC_01732 was corrected based on the resequencing performed by Berscheid et al., 2012 [1].

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAATTTCTACTAAAGGGAGATATGGACTTACATTGATGATTTCTCTTGCTAAAAAA
    GAGGGGCAAGGATGTATATCATTAAAGTCAATTGCTGAAGAAAATAATTTGAGTGATTTA
    TATTTAGAACAGCTTGTAGGTCCTTTAAGAAATGCGGGGTTAATTCGAAGTGTACGCGGT
    GCTAAAGGTGGATACCAATTAAGAGTGCCAGCGGAAGAAATCTCAGCAGGGGATATTATA
    AGACTGTTAGAAGGTCCAATTACATTTGTTGAAAGTATTGAATCAGAACCACCTGCGCAA
    AAACAACTATGGATTCGCATGAGAGATGCAGTGAGAGATGTTTTAGATAATACAACATTG
    AAATATTTAGCGGAATATGTAGATACAAGTGAAGATTTAGACGGATACATGTTTTATATT
    TAA
    60
    120
    180
    240
    300
    360
    420
    423

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01732
  • symbol: SAOUHSC_01732
  • description:
  • length: 140
  • theoretical pI: 4.79134
  • theoretical MW: 15642.9
  • GRAVY: -0.175

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 108.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)
    Signal transduction Regulatory functions DNA interactions iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 88.5)
    and 2 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)
    Signal transduction Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 50.2)
  • TheSEED  :
    • Iron-sulfur cluster regulator IscR
    RNA Metabolism Transcription Rrf2 family transcriptional regulators  Iron-sulfur cluster regulator IscR
    and 1 more
    Stress Response Stress Response - no subcategory Flavohaemoglobin  Iron-sulfur cluster regulator IscR
  • PFAM:
    HTH (CL0123) Rrf2; Transcriptional regulator (PF02082; HMM-score: 94)
    and 3 more
    HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 17.8)
    MarR_2; MarR family (PF12802; HMM-score: 12.8)
    no clan defined PPO1_DWL; Polyphenol oxidase middle domain (PF12142; HMM-score: 12.1)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.065604
    • TAT(Tat/SPI): 0.001286
    • LIPO(Sec/SPII): 0.06428
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt: Q2FXV0 UniProt
  • STRING: 93061.SAOUHSC_01732 STRING

⊟Protein sequence[edit | edit source]

  • MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRGAKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTLKYLAEYVDTSEDLDGYMFYI

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Anne Berscheid, Peter Sass, Konstantin Weber-Lassalle, Ambrose L Cheung, Gabriele Bierbaum
    Revisiting the genomes of the Staphylococcus aureus strains NCTC 8325 and RN4220.
    Int J Med Microbiol: 2012, 302(2);84-7
    [PubMed:22417616] [WorldCat.org] [DOI] (I p)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Olga Soutourina, Olivier Poupel, Jean-Yves Coppée, Antoine Danchin, Tarek Msadek, Isabelle Martin-Verstraete
CymR, the master regulator of cysteine metabolism in Staphylococcus aureus, controls host sulphur source utilization and plays a role in biofilm formation.
Mol Microbiol: 2009, 73(2);194-211
[PubMed:19508281] [WorldCat.org] [DOI] (I p)Olga Soutourina, Sarah Dubrac, Olivier Poupel, Tarek Msadek, Isabelle Martin-Verstraete
The pleiotropic CymR regulator of Staphylococcus aureus plays an important role in virulence and stress response.
PLoS Pathog: 2010, 6(5);e1000894
[PubMed:20485570] [WorldCat.org] [DOI] (I e)

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_01732&oldid=101555"