From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002231 [new locus tag: EGJ38_RS11135 ]
  • pan locus tag?: SAUPAN005722000
  • symbol: EGJ38_002231
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_002231
  • product: MarR family transcriptional regulator

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002231 [new locus tag: EGJ38_RS11135 ]
  • symbol: EGJ38_002231
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2233156..2233596
  • length: 441
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424119 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCTATCACAAGAATTTTTCAATAGTTTTATAACAATATATCGCCCCTATTTAAAATTA
    GCAGAGCCGATTTTGGAAAAACACAATATATATTATGGTCAATGGTTAATCTTACGCGAT
    ATCGCTAAACATCAGCCCACTACTCTCATTGAAATTTCACATAGACGTGCAATTGAAAAG
    CCTACTGCAAGAAAAACTTTAAAAGCTCTAATAGAAAATGACCTTATAACAGTAGAAAAC
    AGTTTAGAGGATAAACGACAAAAGTTTTTAACTTTAACACCTAAAGGGCATGAATTATAT
    GAGATTGTTTGTCTTGATGTACAAAAGCTCCAACAAGCAGTAGTTGCCAAAACAAACATT
    TCGCAAGATCAAATGCAAGAAACCATAAATGTGATGAATCAAATTCATGAAATATTATTA
    AAGGAGGCACACAATGACTAA
    60
    120
    180
    240
    300
    360
    420
    441


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002231 [new locus tag: EGJ38_RS11135 ]
  • symbol: EGJ38_002231
  • description: MarR family transcriptional regulator
  • length: 146
  • theoretical pI: 7.16204
  • theoretical MW: 17151.7
  • GRAVY: -0.368493

Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 50.4)
    and 3 more
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 16.6)
    Signal transduction Regulatory functions DNA interactions beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family (TIGR02431; HMM-score: 12.6)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 12.2)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 39)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 37.1)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 33.8)
    and 9 more
    MarR_2; MarR family (PF12802; HMM-score: 29.2)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 18)
    HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 16.7)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.4)
    DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 16.3)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 15.9)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.7)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 14.5)
    Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 14.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9795
    • Cytoplasmic Membrane Score: 0.0054
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0146
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001286
    • TAT(Tat/SPI): 0.000161
    • LIPO(Sec/SPII): 0.000316
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424119 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]