Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2256 [new locus tag: SACOL_RS11860 ]
- pan locus tag?: SAUPAN005722000
- symbol: SACOL2256
- pan gene symbol?: —
- synonym:
- product: MarR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2256 [new locus tag: SACOL_RS11860 ]
- symbol: SACOL2256
- product: MarR family transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 2322604..2323044
- length: 441
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237838 NCBI
- RefSeq: YP_187063 NCBI
- BioCyc: see SACOL_RS11860
- MicrobesOnline: 913738 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCTATCACAAGAATTTTTCAATAGTTTTATAACAATATATCGCCCCTATTTAAAATTA
GCCGAGCCGATTTTAGAAAAACACAATATATATTATGGCCAATGGTTAATCTTACGCGAT
ATCGCTAAACATCAGCCCACTACTCTCATTGAAATTTCACATAGACGTGCAATTGAAAAG
CCTACTGCAAGAAAAACTTTAAAAGCTCTAATAGAAAATGACCTTATAACAGTAGAAAAC
AGTTTAGAGGATAAACGACAAAAGTTTTTAACTTTAACACCTAAAGGGCATGAATTATAT
GAGATTGTTTGTCTTGATGTACAAAAGCTCCAACAAGCAGTAGTTGCCAAAACAAACATT
TCGCAAGATCAAATGCAAGAAACCATAAATGTGATGAATCAAATTCATGAAATATTATTA
AAGGAGGCACACAATGACTAA60
120
180
240
300
360
420
441
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2256 [new locus tag: SACOL_RS11860 ]
- symbol: SACOL2256
- description: MarR family transcriptional regulator
- length: 146
- theoretical pI: 7.16204
- theoretical MW: 17151.7
- GRAVY: -0.368493
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 50.4)and 3 moreRegulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 16.6)Regulatory functions DNA interactions beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family (TIGR02431; HMM-score: 12.6)putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 12.2)
- TheSEED :
- Transcriptional regulator, MarR family
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 39)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 37.1)Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 33.8)and 9 moreMarR_2; MarR family (PF12802; HMM-score: 29.2)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 18)HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 16.7)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.4)DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 16.3)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 15.9)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.7)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 14.5)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9795
- Cytoplasmic Membrane Score: 0.0054
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0146
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001286
- TAT(Tat/SPI): 0.000161
- LIPO(Sec/SPII): 0.000316
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)