Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002285 [new locus tag: EGJ38_RS11405 ]
- pan locus tag?: SAUPAN005797000
- symbol: EGJ38_002285
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002285
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002285 [new locus tag: EGJ38_RS11405 ]
- symbol: EGJ38_002285
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2283142..2283498
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424171 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTAAAACAAATACTGCCACGTGCTACAAAAATATCGGTACTCTTTGCTGTAGCATTT
TTCATCATAAATTATATCGGTATGGAAAAACCTGACATCCTATATTTAGTTGGAAGAACT
ATTATTGCAACACTTGCTTTCATACTCATTTGTCTTACAGTATTTACTATTATTAATTCT
CCAGAGCGCAAGATTAAACTCGGTACGACTTTACCGATTGCATTAATTATTGGTATCATT
TTCGGCGCCATATTTTTAACGGTACAAATCGGTGTCATCACTGGGTTAATCATCGGTGTG
ATTGCTACGTTTATTTGGGAATTGATTGAAAAAAATAAAGGAGGTCGTTCATCATGA60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002285 [new locus tag: EGJ38_RS11405 ]
- symbol: EGJ38_002285
- description: hypothetical protein
- length: 118
- theoretical pI: 10.5457
- theoretical MW: 12932.8
- GRAVY: 1.17203
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Conjugation type IV conjugative transfer system protein TraL (TIGR02762; HMM-score: 7.4)and 2 morecxxc_20_cxxc protein (TIGR04104; HMM-score: 4.6)oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 3.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 14)no clan defined TM7S3_TM198; TM7S3/TM198-like domain (PF13886; HMM-score: 12.3)and 3 moreDUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 10.5)2heme_cytochrom (CL0328) DUF2427; Domain of unknown function (DUF2427) (PF10348; HMM-score: 9.5)no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0005
- Cytoplasmic Membrane Score: 0.9613
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0379
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004982
- TAT(Tat/SPI): 0.000156
- LIPO(Sec/SPII): 0.006142
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424171 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLKQILPRATKISVLFAVAFFIINYIGMEKPDILYLVGRTIIATLAFILICLTVFTIINSPERKIKLGTTLPIALIIGIIFGAIFLTVQIGVITGLIIGVIATFIWELIEKNKGGRSS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_002285 > EGJ38_002286
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)