From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2110 [new locus tag: SA_RS12125 ]
  • pan locus tag?: SAUPAN005797000
  • symbol: SA2110
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2110 [new locus tag: SA_RS12125 ]
  • symbol: SA2110
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2373404..2373760
  • length: 357
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTAAAACAAATACTGCCACGTGCTACAAAAATATCGATACTCTTTGCTGTAGCATTT
    TTCATCATAAATTATATCGGTATGGAAAAACCTGACATCCTATATTTAGTTGGAAGAACT
    ATTATTGCAACACTTGCTTTCATACTCATTTGTCTTACATTATTTACTATTATTAATTCT
    CCAGAGCGCAAGATTAAACTCGGTACGACTTTACCGATTGCATTAATTATTGGTATCATT
    TTCGGCGCCATATTTTTAACGGTACAAATCGGTGTCATCACTGGGTTAATCATCGGTGTG
    ATTGCTACGTTTATTTGGGAATTGATTGAAAAAAATAAAGGAGGTCGTTCATCATGA
    60
    120
    180
    240
    300
    357

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2110 [new locus tag: SA_RS12125 ]
  • symbol: SA2110
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 10.5457
  • theoretical MW: 12960.8
  • GRAVY: 1.17119

Function[edit | edit source]

  • TIGRFAM:
    YhgE/Pip C-terminal domain (TIGR03062; HMM-score: 13.9)
    and 2 more
    Cellular processes Cellular processes Conjugation type IV conjugative transfer system protein TraL (TIGR02762; HMM-score: 7.2)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 3.6)
  • TheSEED  :
    • Hypothetical protein SAV2317
  • PFAM:
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 14.5)
    no clan defined TM7S3_TM198; TM7S3/TM198-like domain (PF13886; HMM-score: 12.7)
    and 2 more
    DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 10.2)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0006
    • Cytoplasmic Membrane Score: 0.9497
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0494
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004389
    • TAT(Tat/SPI): 0.000146
    • LIPO(Sec/SPII): 0.006167
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLKQILPRATKISILFAVAFFIINYIGMEKPDILYLVGRTIIATLAFILICLTLFTIINSPERKIKLGTTLPIALIIGIIFGAIFLTVQIGVITGLIIGVIATFIWELIEKNKGGRSS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]