From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002285
  • pan locus tag?: SAUPAN005797000
  • symbol: JSNZ_002285
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002285
  • symbol: JSNZ_002285
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2283142..2283498
  • length: 357
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTAAAACAAATACTGCCACGTGCTACAAAAATATCGGTACTCTTTGCTGTAGCATTT
    TTCATCATAAATTATATCGGTATGGAAAAACCTGACATCCTATATTTAGTTGGAAGAACT
    ATTATTGCAACACTTGCTTTCATACTCATTTGTCTTACAGTATTTACTATTATTAATTCT
    CCAGAGCGCAAGATTAAACTCGGTACGACTTTACCGATTGCATTAATTATTGGTATCATT
    TTCGGCGCCATATTTTTAACGGTACAAATCGGTGTCATCACTGGGTTAATCATCGGTGTG
    ATTGCTACGTTTATTTGGGAATTGATTGAAAAAAATAAAGGAGGTCGTTCATCATGA
    60
    120
    180
    240
    300
    357

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_002285
  • symbol: JSNZ_002285
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 10.5457
  • theoretical MW: 12932.8
  • GRAVY: 1.17203

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Conjugation type IV conjugative transfer system protein TraL (TIGR02762; HMM-score: 7.4)
    and 2 more
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 4.6)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 3.4)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 14)
    no clan defined TM7S3_TM198; TM7S3/TM198-like domain (PF13886; HMM-score: 12.3)
    and 3 more
    DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 10.5)
    2heme_cytochrom (CL0328) DUF2427; Domain of unknown function (DUF2427) (PF10348; HMM-score: 9.5)
    no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0005
    • Cytoplasmic Membrane Score: 0.9613
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0379
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004982
    • TAT(Tat/SPI): 0.000156
    • LIPO(Sec/SPII): 0.006142
  • predicted transmembrane helices (TMHMM): 4

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MLKQILPRATKISVLFAVAFFIINYIGMEKPDILYLVGRTIIATLAFILICLTVFTIINSPERKIKLGTTLPIALIIGIIFGAIFLTVQIGVITGLIIGVIATFIWELIEKNKGGRSS

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=JSNZ_002285&oldid=107926"