Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2266 [new locus tag: SAUSA300_RS12520 ]
- pan locus tag?: SAUPAN005797000
- symbol: SAUSA300_2266
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2266 [new locus tag: SAUSA300_RS12520 ]
- symbol: SAUSA300_2266
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2436628..2436984
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3912991 NCBI
- RefSeq: YP_494901 NCBI
- BioCyc: see SAUSA300_RS12520
- MicrobesOnline: 1293781 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTAAAACAAATACTGCTACGTGCTACAAAAATATCGGTACTCTTTGCTGTAGCATTT
TTCATCATAAATTATATCGGTATGGAAAAACCTGACATCCTATATTTAGTTGGAAGAACT
ATTATTGCAACACTTGCTTTCATACTCATTTGTCTTACAGTATTTACTATTATTAATTCT
CCAGAGCGCAAGATTAAACTCGGTACGACTTTACCGATTGCATTAATTATTGGTATCATT
TTCGGCGCCATATTTTTAACGGTACAAATCGGTGTCATCACTGGGTTAATCATCGGTGTG
ATTGCTACGTTTATTTGGGAATTGATTGAAAAAAATAAAGGAGGTCGTTCATCATGA60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2266 [new locus tag: SAUSA300_RS12520 ]
- symbol: SAUSA300_2266
- description: hypothetical protein
- length: 118
- theoretical pI: 10.5457
- theoretical MW: 12948.8
- GRAVY: 1.2178
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Conjugation type IV conjugative transfer system protein TraL (TIGR02762; HMM-score: 7.5)and 1 moreoligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 2.8)
- TheSEED :
- Hypothetical protein SAV2317
- PFAM: Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 14.6)no clan defined TM7S3_TM198; TM7S3/TM198-like domain (PF13886; HMM-score: 11.8)and 2 moreDUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 9.8)DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 7.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.9412
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0579
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004444
- TAT(Tat/SPI): 0.000166
- LIPO(Sec/SPII): 0.008378
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKQILLRATKISVLFAVAFFIINYIGMEKPDILYLVGRTIIATLAFILICLTVFTIINSPERKIKLGTTLPIALIIGIIFGAIFLTVQIGVITGLIIGVIATFIWELIEKNKGGRSS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]