From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002337 [new locus tag: EGJ38_RS11665 ]
  • pan locus tag?: SAUPAN005883000
  • symbol: EGJ38_002337
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_002337
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002337 [new locus tag: EGJ38_RS11665 ]
  • symbol: EGJ38_002337
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2336050..2336655
  • length: 606
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424223 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAGATTAGTTACAGGGTTACTAGCATTATCATTATTTTTAGCTGCATGTGGTCAA
    GATAGTGACCAACAAAAAGACGGTAATAAAGAAAAAGATGATAAAGCGAAAACTGAACAA
    CAAGATAAAAAAACAAATGATTCATCTAAAGATAAGAAAGATAATAAAGATGATAGTAAA
    GACGTAAACAACGATAACCAGCAACAATCTAATTCAAATGCAACAAACAATGACCAAAAC
    CAAACAAATAATAACCAATCAAGTAATAACCAAGCGAATAATAATCAAAAATCAAGTTAC
    GTTGCACCATATTATGGACAAAATGCCGCGCCGGTTGCACGTCAAATTTATCCGTTTAAT
    GGAAATAAAACTCAAGCTTTACAGCAATTGCCAAATTTCCAAACAGCTTTAAATGCGGCT
    AATAATGAAGCAAATAAATTTGGTAGTAATAATAAAGTGTATAATGATTATTCTATTGAA
    GAACATAATGGCAACTATAAGTATGTGTTTAGTTTTAAAGACCCAAATGCAAATGGAAAA
    TATTCAATTGTAACGGTTGATTATACTGGACAAGCAATGGTTACTGATCCAAACTACCAA
    CAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    606


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002337 [new locus tag: EGJ38_RS11665 ]
  • symbol: EGJ38_002337
  • description: hypothetical protein
  • length: 201
  • theoretical pI: 5.95757
  • theoretical MW: 22475.9
  • GRAVY: -1.3806

Function[edit | edit source]

  • TIGRFAM:
    Sec region non-globular protein (TIGR04420; HMM-score: 16.3)
    and 4 more
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 9.7)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 8.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 8.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.4)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 14.9)
    no clan defined Nop14; Nop14-like family (PF04147; HMM-score: 14.4)
    HAD (CL0137) CDC45; CDC45 (PF02724; HMM-score: 14.1)
    no clan defined PCYCGC; Protein of unknown function with PCYCGC motif (PF13798; HMM-score: 13)
    Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 12.9)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 12)
    and 15 more
    no clan defined SLC12; Solute carrier family 12 (PF03522; HMM-score: 10.6)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.4)
    no clan defined DUF6474; Family of unknown function (DUF6474) (PF20079; HMM-score: 10.2)
    MFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 9.6)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 9.1)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 8.9)
    no clan defined TMEM51; Transmembrane protein 51 (PF15345; HMM-score: 8.3)
    MCM_bind; Mini-chromosome maintenance replisome factor (PF09739; HMM-score: 8.2)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 8.1)
    no clan defined FAM176; FAM176 family (PF14851; HMM-score: 8.1)
    NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 7.9)
    no clan defined CobT; Cobalamin biosynthesis protein CobT (PF06213; HMM-score: 7.9)
    Mat89Bb; Cell cycle and development regulator Mat89Bb (PF10221; HMM-score: 6.9)
    Otopetrin; Otopetrin (PF03189; HMM-score: 6.4)
    Raftlin; Raftlin (PF15250; HMM-score: 5.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.812
    • Cell wall & surface Score: 0.0351
    • Extracellular Score: 0.1528
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000417
    • TAT(Tat/SPI): 0.00006
    • LIPO(Sec/SPII): 0.99935
    • Cleavage Site: CS pos: 17-18. LAA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424223 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSKDVNNDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPVARQIYPFNGNKTQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSFKDPNANGKYSIVTVDYTGQAMVTDPNYQQ

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1] [2] [3]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  2. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  3. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]