Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002350 [new locus tag: EGJ38_RS11730 ]
- pan locus tag?: SAUPAN005907000
- symbol: EGJ38_002350
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002350
- product: pyridoxamine 5'-phosphate oxidase family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002350 [new locus tag: EGJ38_RS11730 ]
- symbol: EGJ38_002350
- product: pyridoxamine 5'-phosphate oxidase family protein
- replicon: chromosome
- strand: +
- coordinates: 2349874..2350296
- length: 423
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424236 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGTAACTCACAAGCAATTCAAGCAATTGAAAACGTGTTAGCAACGTCAAAAGTTGGT
GTATTATCAACTGCATATAATAACAAACCTAATAGTAGATATATGGTCTTTTATAATGAT
GGTCTTACTTTATATACTAAAACGAATATCCATTCTGCTAAGGTCAAAGAAATTAAAGAA
AACCCAGCAGCCTATGTATTGTTAGGTTACAATGATACGACAAATCGCAGTTTCGTTGAA
ATGGAAGCCACGATAGAAGTAGTTACTGATCAAAAAGTAATCGATTGGTTATGGGAGACT
CAAGATAAAAGCTTTTTCAGTTCAAAAGAAGACCCAGAACTTTGTGTTTTAAGAGTAGTT
CCGCAATCCATTAAGCTAATGAATGATAAATCATTAGATACACCTATCAAAATCGATTTA
TAA60
120
180
240
300
360
420
423
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002350 [new locus tag: EGJ38_RS11730 ]
- symbol: EGJ38_002350
- description: pyridoxamine 5'-phosphate oxidase family protein
- length: 140
- theoretical pI: 4.9169
- theoretical MW: 15871
- GRAVY: -0.301429
⊟Function[edit | edit source]
- TIGRFAM: Unknown function Enzymes of unknown specificity PPOX class probable F420-dependent enzyme (TIGR03618; HMM-score: 28.1)and 4 moreUnknown function Enzymes of unknown specificity PPOX class probable F420-dependent enzyme, Rv3369 family (TIGR03667; EC 1.-.-.-; HMM-score: 19.8)Biosynthesis of cofactors, prosthetic groups, and carriers Pyridoxine pyridoxamine 5'-phosphate oxidase (TIGR00558; EC 1.4.3.5; HMM-score: 18.7)Unknown function Enzymes of unknown specificity PPOX class probable FMN-dependent enzyme, alr4036 family (TIGR04026; EC 1.-.-.-; HMM-score: 14.8)Unknown function Enzymes of unknown specificity PPOX class probable F420-dependent enzyme, Rv2061 family (TIGR03666; EC 1.-.-.-; HMM-score: 11.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: FMN-binding (CL0336) PNPOx_N; Pyridoxamine 5'-phosphate oxidase (PF01243; HMM-score: 59.9)Pyrid_ox_like; Pyridoxamine 5'-phosphate oxidase like (PF16242; HMM-score: 48.2)and 2 morePyridox_ox_2; Pyridoxamine 5'-phosphate oxidase (PF12900; HMM-score: 18.7)SH3 (CL0010) Tudor_5; Histone methyltransferase Tudor domain 1 (PF18359; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9845
- Cytoplasmic Membrane Score: 0.0013
- Cell wall & surface Score: 0
- Extracellular Score: 0.0142
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021369
- TAT(Tat/SPI): 0.002074
- LIPO(Sec/SPII): 0.015925
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424236 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNSQAIQAIENVLATSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKENPAAYVLLGYNDTTNRSFVEMEATIEVVTDQKVIDWLWETQDKSFFSSKEDPELCVLRVVPQSIKLMNDKSLDTPIKIDL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)