Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS07790 [old locus tag: EGJ38_001560 ]
- pan locus tag?: SAUPAN004151000
- symbol: EGJ38_RS07790
- pan gene symbol?: dgkA
- synonym:
- product: diacylglycerol kinase family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS07790 [old locus tag: EGJ38_001560 ]
- symbol: EGJ38_RS07790
- product: diacylglycerol kinase family protein
- replicon: chromosome
- strand: -
- coordinates: 1596919..1597263
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1596919..1597263) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAGGTTTAAATATGCACTTGATGGGCTGAAAATCTTAATTCAAAAAGACTATAAA
TTTCTTTTACATGTGTTTGCAATGATTGTTGCTATTGTCTTTGGTCTCGTACTAAATATT
AATCGGATTGAGTGGATATTTATACTCATTGCTATTGCATTAGTTCTCACTGTTGAAGCT
TTAAACACTGCTATTGAATATGTTGTCGATTTAGTGACCGTTGAATATCATGATTTAGCT
AAATACGCAAAAGATATAGCGGCTTTTAGTGTACTTATAGTTTCAATATTAGCATTTATT
ATAGGTTTAATAGTATTTTTACCACATTTTATAGCGTTATTTTAG60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS07790 [old locus tag: EGJ38_001560 ]
- symbol: EGJ38_RS07790
- description: diacylglycerol kinase family protein
- length: 114
- theoretical pI: 7.76368
- theoretical MW: 12969.7
- GRAVY: 1.35
⊟Function[edit | edit source]
- reaction: EC 2.7.1.-? ExPASy
- TIGRFAM: cxxc_20_cxxc protein (TIGR04104; HMM-score: 5.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DAGK_prokar; Prokaryotic diacylglycerol kinase (PF01219; HMM-score: 112.1)and 4 moreDUF1405; Protein of unknown function (DUF1405) (PF07187; HMM-score: 11.8)2heme_cytochrom (CL0328) DUF2427; Domain of unknown function (DUF2427) (PF10348; HMM-score: 7.2)no clan defined DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 7)Transporter (CL0375) SUR7; SUR7/PalI family (PF06687; HMM-score: 6.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9999
- Cell wall & surface Score: 0
- Extracellular Score: 0.0001
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005147
- TAT(Tat/SPI): 0.000083
- LIPO(Sec/SPII): 0.001165
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000819532 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEALNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]