From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1398 [new locus tag: SA_RS07900 ]
  • pan locus tag?: SAUPAN004151000
  • symbol: SA1398
  • pan gene symbol?: dgkA
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1398 [new locus tag: SA_RS07900 ]
  • symbol: SA1398
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1604006..1604350
  • length: 345
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAGGTTTAAATATGCACTTGATGGGCTGAAAATCTTAATTCAAAAAGACTATAAA
    TTTCTTTTACATGTGTTTGCAATGATTGTTGCTATTGTCTTTGGTCTCGTACTAAATATT
    AATCGTATTGAGTGGATATTTATACTCATTGCTATTGCATTAGTTCTCACTGTTGAAGCT
    TTAAACACTGCTATTGAATATGTTGTCGATTTAGTGACCGTTGAATATCATGATTTAGCT
    AAATACGCAAAAGATATAGCGGCTTTTAGTGTACTTATAGTTTCAATATTAGCATTTATT
    ATAGGTTTAATAGTATTTTTACCACATTTTATAGCGTTATTTTAG
    60
    120
    180
    240
    300
    345


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1398 [new locus tag: SA_RS07900 ]
  • symbol: SA1398
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 7.76368
  • theoretical MW: 12969.7
  • GRAVY: 1.35

Function[edit | edit source]

  • TIGRFAM:
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 5.3)
  • TheSEED  :
    • Undecaprenol kinase (EC 2.7.1.66)
    Fatty Acids, Lipids, and Isoprenoids Phospholipids Glycerolipid and Glycerophospholipid Metabolism in Bacteria  Diacylglycerol kinase (EC 2.7.1.107)
  • PFAM:
    no clan defined DAGK_prokar; Prokaryotic diacylglycerol kinase (PF01219; HMM-score: 112.1)
    and 4 more
    DUF1405; Protein of unknown function (DUF1405) (PF07187; HMM-score: 11.8)
    2heme_cytochrom (CL0328) DUF2427; Domain of unknown function (DUF2427) (PF10348; HMM-score: 7.2)
    no clan defined DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 7)
    Transporter (CL0375) SUR7; SUR7/PalI family (PF06687; HMM-score: 6.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9999
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0001
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005147
    • TAT(Tat/SPI): 0.000083
    • LIPO(Sec/SPII): 0.001165
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEALNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]