Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS12815 [old locus tag: EGJ38_002567 ]
- pan locus tag?: SAUPAN006265000
- symbol: EGJ38_RS12815
- pan gene symbol?: lapT2
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS12815 [old locus tag: EGJ38_002567 ]
- symbol: EGJ38_RS12815
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2574399..2574761
- length: 363
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2574399..2574761) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCGAATAAACTGGATGAAATCAATAAAATAATCACAGCGAAACATAAGCAAATGGAT
GACTTATATGATGAAAAGCGAGAGGTTAAAGCATTGATAGATGAAAGTGATGCGCTTAAT
CATTCGATAGATCAATTATATCAACATTTAGGTGAGCGTTATTATAGTAGCAATATGGCT
AGTCGTATGGAACAGTTCCGTGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGCGGAAGAAGAGATGATT
GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACTTGCAATGGAAACCGTATA
TAG60
120
180
240
300
360
363
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS12815 [old locus tag: EGJ38_002567 ]
- symbol: EGJ38_RS12815
- description: hypothetical protein
- length: 120
- theoretical pI: 5.2872
- theoretical MW: 14380
- GRAVY: -1.045
⊟Function[edit | edit source]
- TIGRFAM: conserved hypothetical protein (TIGR02231; HMM-score: 14.4)and 2 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 10.3)DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DUF3958; Protein of unknown function (DUF3958) (PF13125; HMM-score: 22.8)and 9 moreFAD-oxidase_C (CL0277) Lact-deh-memb; D-lactate dehydrogenase, membrane binding (PF09330; HMM-score: 16.5)6_Hairpin (CL0059) Beta-AFase-like_GH127_cat; Beta-L-arabinofuranosidase, GH127 catalytic domain (PF07944; HMM-score: 13.4)no clan defined YabA; Initiation control protein YabA (PF06156; HMM-score: 12.4)CCDC90-like; Coiled-coil domain-containing protein 90-like (PF07798; HMM-score: 12.2)TssO; Type VI secretion system, TssO (PF17561; HMM-score: 11.6)tRNA_bind_arm (CL0298) Seryl_tRNA_N; Seryl-tRNA synthetase N-terminal domain (PF02403; HMM-score: 11.3)no clan defined SlyX; SlyX (PF04102; HMM-score: 11.2)NBD94; Nucleotide-Binding Domain 94 of RH (PF16830; HMM-score: 9.5)UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5607
- Cytoplasmic Membrane Score: 0.0771
- Cell wall & surface Score: 0.0035
- Extracellular Score: 0.3587
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002274
- TAT(Tat/SPI): 0.000452
- LIPO(Sec/SPII): 0.000323
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000066355 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNKLDEINKIITAKHKQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKAEEEMIDLEMRRNVEIETVTCNGNRI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]